DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and Cntn6

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_059079.2 Gene:Cntn6 / 53870 MGIID:1858223 Length:1028 Species:Mus musculus


Alignment Length:579 Identity:122/579 - (21%)
Similarity:211/579 - (36%) Gaps:169/579 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 VEEFDSGTSTSDLIARKSREEAEEEEDEGPLEPRVLPLRPVPPNPYEAE-EM---SVVYAEQHSE 253
            ||..|.|..|..:..:::....     :||..|.||....| ...||.: |:   ..:.|.:.|.
Mouse   186 VEPSDVGNYTCFVTNKEAHRSV-----QGPPTPLVLRTDGV-MGEYEPKIEVRFPETIQAAKDSS 244

  Fly   254 IKLMC-EVDLDIATSMWYKNGQVVHAMDRTARVTDYRFIKEANGALTITNVMLEDDGKWQCEAEN 317
            |||.| .:...:....|.:       :|.:......::.| :...|.|.....||:|.::|.|.|
Mouse   245 IKLECFALGNPVPDISWKR-------LDGSPMPGKIKYSK-SQAILEIPKFQQEDEGFYECIAGN 301

  Fly   318 TRRYTENARPVKLVVLDRP------KPPYLLI-DSRRLDASNLFVPVKENSELNLACVSEGGNPR 375
            .|  ..|....:|:....|      :..||.| ||       ||...|.:           |||.
Mouse   302 LR--GRNLAKGQLIFYAPPEWEQKIQNTYLSIYDS-------LFWECKAS-----------GNPN 346

  Fly   376 PTLTWEVLLSPGVDRHAQKVSAEVLELEEIKGEKLDKDGYKI-------NSGAKSEARLPAVYRA 433
            |:.||.        ::.|:::.|    |.|:.|    :|..|       :||         :|: 
Mouse   347 PSYTWL--------KNGQRLNTE----ERIQIE----NGTLIITMLNISDSG---------IYQ- 385

  Fly   434 HHNARILCVMEHPTLKIRQNASLLLDVQYTPSFAISRTPGFG-YPLRE------GIEVSLKCDVD 491
                   |..|:....|..||.|.:         ::..|.|. .|:::      |.::|::|..:
Mouse   386 -------CAAENKYQTIYANAELRV---------LASAPDFSKNPIKKISVVQVGGDISIECKPN 434

  Fly   492 SNPPSTPRWQKDDGDTPVPQT------GDGFLNFTSIRREHSGWYKCTSRHLNFQY----SSIGY 546
            :.|.::..|::  |...:.|:      .||.|...::.|..:|.|.|.:.:   |:    ||.|.
Mouse   435 AFPKASISWKR--GTENLKQSKRVLFLEDGSLKICNVTRADAGSYTCVATN---QFGNGKSSGGL 494

  Fly   547 YLSVRFDSVDVTSEPDDQDVSVAAA-------SHNPNKGQLEVQLGGAVTLQCPQGSLGCWSHLD 604
            .:..|   ..:|..|...||:|..:       ||:|....|.|.......:...:|.    :|.:
Mouse   495 VVKER---TIITVPPSKMDVTVGESIVLPCQVSHDPTMEVLFVWYFNGDIIDLKKGV----AHFE 552

  Fly   605 PISARLRGLGYGSSQPTGQFSLKDVMYQDAGMYKCVGQSPTNKKKLEVLQSVT-VSVKGAPTVMA 668
            .|          ..:..|...::::....:|.|.|..|:     .||.|.:|. :.|:|.     
Mouse   553 RI----------GGESVGDLMIRNIQLGHSGKYLCTVQT-----TLERLSAVADIIVRGP----- 597

  Fly   669 LNATPVAYPGSPLHLNVEFCANPPAHAARWLHGDRVFTPGNQYGTTVLAYAVKDLPTPF 727
                    ||.|..:.||..::..:..: |       .||....:.:..:.:: ..|||
Mouse   598 --------PGPPEDVKVEHISSTTSQLS-W-------RPGPDNNSPIQIFTIQ-TRTPF 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 20/88 (23%)
Ig strand B 254..258 CDD:409353 3/3 (100%)
Ig strand C 267..271 CDD:409353 1/3 (33%)
Ig strand E 296..300 CDD:409353 1/3 (33%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 0/2 (0%)
Ig 359..452 CDD:472250 19/99 (19%)
Ig_3 478..533 CDD:464046 13/66 (20%)
IG_like 578..660 CDD:214653 14/82 (17%)
Cntn6NP_059079.2 Ig 26..120 CDD:472250
Ig strand B 46..50 CDD:409353
Ig strand C 59..63 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 97..102 CDD:409353
Ig strand G 111..114 CDD:409353
Ig 129..214 CDD:472250 7/32 (22%)
Ig strand B 140..144 CDD:409353
Ig strand C 154..158 CDD:409353
Ig strand E 179..183 CDD:409353
Ig strand F 193..198 CDD:409353 1/4 (25%)
Ig strand G 209..212 CDD:409353 2/2 (100%)
Ig 227..315 CDD:472250 21/97 (22%)
Ig strand B 245..249 CDD:409353 3/3 (100%)
Ig strand C 258..262 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 1/3 (33%)
Ig strand F 294..299 CDD:409353 1/4 (25%)
Ig strand G 307..310 CDD:409353 0/2 (0%)
Ig 319..403 CDD:472250 30/134 (22%)
Ig strand B 335..339 CDD:143205 2/3 (67%)
Ig strand C 348..352 CDD:143205 1/3 (33%)
Ig strand E 369..373 CDD:143205 1/3 (33%)
Ig strand F 383..388 CDD:143205 2/12 (17%)
Ig strand G 396..399 CDD:143205 0/2 (0%)
Ig5_Contactin 408..496 CDD:409358 21/92 (23%)
Ig strand A 408..413 CDD:409358 2/4 (50%)
Ig strand A' 416..421 CDD:409358 0/4 (0%)
Ig strand B 425..432 CDD:409358 1/6 (17%)
Ig strand C 440..444 CDD:409358 0/3 (0%)
Ig strand D 458..461 CDD:409358 0/2 (0%)
Ig strand E 462..467 CDD:409358 2/4 (50%)
Ig strand F 475..483 CDD:409358 3/7 (43%)
Ig strand G 489..496 CDD:409358 3/6 (50%)
Ig 500..598 CDD:472250 24/129 (19%)
Ig strand B 517..521 CDD:409353 0/3 (0%)
Ig strand C 532..536 CDD:409353 2/3 (67%)
Ig strand E 560..564 CDD:409353 1/3 (33%)
Ig strand F 574..579 CDD:409353 2/4 (50%)
Ig strand G 587..590 CDD:409353 0/2 (0%)
FN3 598..691 CDD:238020 11/51 (22%)
FN3 <620..>912 CDD:442628 5/21 (24%)
FN3 903..983 CDD:214495
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.