DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and CNTN3

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_065923.1 Gene:CNTN3 / 5067 HGNCID:2173 Length:1028 Species:Homo sapiens


Alignment Length:585 Identity:119/585 - (20%)
Similarity:214/585 - (36%) Gaps:169/585 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 GPLEPRVLPLRPVPPNPYEAEEMSVVYAEQHSEIKLMC-EVDLDIATSMWYKNGQVVHAMDRTAR 284
            |..||::           |.:....:.|.:.|.:||.| .:...|....|.::    ..:..:::
Human   223 GEYEPKI-----------EVQFPETLPAAKGSTVKLECFALGNPIPQINWRRS----DGLPFSSK 272

  Fly   285 VTDYRFIKEANGALTITNVMLEDDGKWQCEAENTRRYTENARPVKLVVLDRPKPPYLLIDSRRLD 349
            :.    :::.:|.|.|.|...||.|.::|.|||:|  .:|....:|....:|....|:.|     
Human   273 IK----LRKFSGVLEIPNFQQEDAGSYECIAENSR--GKNVARGRLTYYAKPHWVQLIKD----- 326

  Fly   350 ASNLFVPVKENSELNLACVSEGGNPRPTLTWEVLLSPGVDRHAQKVSAEVLELEEIKGEKLDKDG 414
                 |.:.....|...| ...|.|:|:..|   |..|        :|.|||           :.
Human   327 -----VEIAVEDSLYWEC-RASGKPKPSYRW---LKNG--------AALVLE-----------ER 363

  Fly   415 YKINSGAKSEARLPAVYRAHHNARILCVMEHPTLKIRQNASLLLDVQYTPSFAISRTPGFGYPLR 479
            .:|.:||.:.:.|...    .:....|:.|:....:..:|.|.: |...|.|:.:       |::
Human   364 TQIENGALTISNLSVT----DSGMFQCIAENKHGLVYSSAELKV-VASAPDFSKN-------PMK 416

  Fly   480 E------GIEVSLKCDVDSNPPSTPRWQKDDGDTPVPQ------TGDGFLNFTSIRREHSGWYKC 532
            :      |..|||.|...::|.:...|:|  ||..|.:      ..||.|...::.:..:|.|.|
Human   417 KLVQVQVGSLVSLDCKPRASPRALSSWKK--GDVSVQEHERISLLNDGGLKIANVTKADAGTYTC 479

  Fly   533 TSRHLNFQYSSIGYYLSVRFDSVDVTSEPDDQDVSVAAASHNPNKGQLEVQLGGAVTLQCP---- 593
            .:.: .|..::...:|.|. :...:|..|.:.||||                |.:|.|.|.    
Human   480 MAEN-QFGKANGTTHLVVT-EPTRITLAPSNMDVSV----------------GESVILPCQVQHD 526

  Fly   594 -----------QGSLGCW----SHLDPISARLRGLGYGSSQPTGQFSLKDVMYQDAGMYKCVGQS 643
                       .|:|..:    ||.:.:.        |||  :|...::::..:.:|.|.|:.|:
Human   527 PLLDIIFTWYFNGALADFKKDGSHFEKVG--------GSS--SGDLMIRNIQLKHSGKYVCMVQT 581

  Fly   644 PTNKKKLEVLQSVTVSVKGAPTVMALNATPVAYPGSPLHLNVEFCANPPAHAARWLHGDRVFTPG 708
            ..:    .|..:..:.|:|:             ||.|.::.|:...:..|..: |..|....:| 
Human   582 GVD----SVSSAADLIVRGS-------------PGPPENVKVDEITDTTAQLS-WKEGKDNHSP- 627

  Fly   709 NQYGTTVLAYAVKDLPTPFC---------------KEARLTYVSMHERVPRTFYFIVSTPGGVAE 758
                  |::|::: ..|||.               |....|.|.::..|...|..:.|...|..|
Human   628 ------VISYSIQ-ARTPFSVGWQTVTTVPEVIDGKTHTATVVELNPWVEYEFRVVASNKIGGGE 685

  Fly   759  758
            Human   686  685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 21/88 (24%)
Ig strand B 254..258 CDD:409353 2/3 (67%)
Ig strand C 267..271 CDD:409353 1/3 (33%)
Ig strand E 296..300 CDD:409353 2/3 (67%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 0/2 (0%)
Ig 359..452 CDD:472250 18/92 (20%)
Ig_3 478..533 CDD:464046 16/66 (24%)
IG_like 578..660 CDD:214653 17/100 (17%)
CNTN3NP_065923.1 Ig 25..120 CDD:472250
Ig strand B 46..50 CDD:409353
Ig strand C 59..63 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 97..102 CDD:409353
Ig strand G 111..114 CDD:409353
Ig 129..214 CDD:472250
Ig strand B 140..144 CDD:409353
Ig strand C 154..158 CDD:409353
Ig strand E 179..183 CDD:409353
Ig strand F 193..198 CDD:409353
Ig strand G 209..212 CDD:409353
Ig 227..315 CDD:472250 23/108 (21%)
Ig strand B 245..249 CDD:409353 2/3 (67%)
Ig strand C 258..262 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 2/3 (67%)
Ig strand F 294..299 CDD:409353 1/4 (25%)
Ig strand G 307..310 CDD:409353 0/2 (0%)
Ig 320..403 CDD:472250 23/119 (19%)
Ig strand B 335..339 CDD:143205 1/3 (33%)
Ig strand C 348..352 CDD:143205 1/6 (17%)
Ig strand E 369..373 CDD:143205 2/3 (67%)
Ig strand F 383..388 CDD:143205 1/4 (25%)
Ig strand G 396..399 CDD:143205 0/2 (0%)
Ig 408..496 CDD:472250 22/97 (23%)
Ig strand B 427..431 CDD:409353 3/3 (100%)
Ig strand C 440..444 CDD:409353 0/3 (0%)
Ig strand E 462..466 CDD:409353 2/3 (67%)
Ig strand F 476..481 CDD:409353 2/4 (50%)
Ig strand G 489..492 CDD:409353 0/2 (0%)
Ig 498..598 CDD:472250 25/142 (18%)
Ig strand B 517..521 CDD:409439 2/3 (67%)
Ig strand C 532..536 CDD:409439 0/3 (0%)
Ig strand E 560..564 CDD:409439 1/3 (33%)
Ig strand F 574..579 CDD:409439 2/4 (50%)
FN3 579..>1006 CDD:442628 25/133 (19%)
Ig strand G 587..590 CDD:409439 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 684..713 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.