DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17716 and CG45263

DIOPT Version :9

Sequence 1:NP_001286391.1 Gene:CG17716 / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_731246.2 Gene:CG45263 / 50003 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster


Alignment Length:591 Identity:130/591 - (21%)
Similarity:217/591 - (36%) Gaps:148/591 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 YAEQ--HSEIK------LMCEVDLDIATSMWYK----------------------NGQVVHAMDR 281
            ::||  ::|:.      |.|:|.....|..|.|                      ||.|:|....
  Fly    54 FSEQPKYTEVNPAEDTLLTCKVIDKRGTCSWQKDNKPVGIYTKKYEWASRMPTSDNGNVLHLDLH 118

  Fly   282 TARVTDYRFIKEANG--ALTITNVMLE-DDGKWQCEAENTRRYTENA---RPVKLVVLDRPKPPY 340
            ...|       :..|  :|.|.:..|: |||.|:|:...:...|::|   :||:|||...|:.| 
  Fly   119 PPPV-------QLGGDCSLWIRSATLDFDDGLWECQVTASDFTTQDALTSQPVRLVVRVAPQRP- 175

  Fly   341 LLIDSRRLDASNLFVPVKEN------SELNLACVSEGGNPRPTLTW---EVLLSPGVDRHAQKVS 396
                  ||:...:.||...|      :...:.|:|..|||..||.|   :..:||   .|.|..:
  Fly   176 ------RLEYEAVHVPPGHNITADAGALATVKCISHYGNPPATLKWFLGDQEISP---IHPQMNA 231

  Fly   397 AEVLELEEIKGEKLDKDGYKINSGAKSEARLPAVYRAHHNARILCVMEHPTLKIRQ-NASLLLDV 460
            .|             .|..:..| |.|..::.|: |..|...:.|...|.:...:. .....|||
  Fly   232 TE-------------PDNPRTWS-ATSVVQVSAM-RERHGDILRCAAYHESYTAKSVVVEARLDV 281

  Fly   461 QYTPSFAISRTPGFGYPLREGIE-VSLKCDVDSNPPSTPRWQKDDGDTPVPQTGDGFLNFTSIRR 524
            :|.||..:..:|..  .|.|..: :.|:|..|:|||::..|:: .|.:.:....: .|....:.|
  Fly   282 KYAPSIRLIGSPEI--DLEEDKDALVLRCVADANPPASIVWRR-AGRSEIASLQE-TLQLRPVGR 342

  Fly   525 EHSGWYKC-------TSRHLNFQYSSIGYYLSVRFDSVDVTSEPDDQDVSVAAASHNPNKGQLEV 582
            ..:|.|.|       ||..|:.|       |.|::....:::.||.   ...|...:|       
  Fly   343 RDAGLYTCQAQNSVGTSEQLSVQ-------LDVKYPPKIISAGPDR---LTTAPLFSP------- 390

  Fly   583 QLGGAVTLQCPQGSLGCWSHLDP------ISARLRGLGYGSSQPTGQFSLKDVMYQDAGMYKCVG 641
                        .:..|.:..:|      :.....|..|.......:..:.:|.|:..|.|:|..
  Fly   391 ------------AAFECLADGNPLPSFKWVQRMAHGSKYVERGSESRLVIDNVTYEYQGEYECRA 443

  Fly   642 QSPTN-KKKLEVLQSVTVSVKGAPTVMALNA---TPVAYPGSPLHLNVEFCANPPAHAARWLHGD 702
            .|..| ::::.:...|::.|.|||.|:.|:.   |.....|....|.:..||:|......|..|.
  Fly   444 TSYINGQERVAISDPVSLQVVGAPQVLRLHPSLHTVSVKRGEAASLTMVVCADPRPQRVAWEWGS 508

  Fly   703 -RVFTPGNQYGTTVLAYAVKDLPTPF---CKEARLTYVSMHERVPRTFYFIVSTPGGVAEAIFNV 763
             |:     :.|:.:..:...|:....   |..:.|..:...|...|.:|.:|....|        
  Fly   509 LRL-----EAGSGIDRFRADDMQPDTREDCYLSTLHILHADEHDSRPYYLVVENERG-------- 560

  Fly   764 NFTKRH 769
              |.||
  Fly   561 --TDRH 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17716NP_001286391.1 IG_like 244..332 CDD:214653 28/120 (23%)
Ig 254..323 CDD:143165 20/99 (20%)
Ig 359..452 CDD:299845 23/101 (23%)
Ig_3 477..536 CDD:290638 17/66 (26%)
IG_like 479..550 CDD:214653 19/78 (24%)
IG_like 578..660 CDD:214653 12/88 (14%)
CG45263NP_731246.2 I-set 53..149 CDD:254352 23/101 (23%)
Ig 198..281 CDD:299845 23/100 (23%)
IG_like 302..368 CDD:214653 18/74 (24%)
IGc2 302..357 CDD:197706 13/56 (23%)
Ig 372..446 CDD:299845 13/95 (14%)
Ig 475..568 CDD:299845 21/105 (20%)
IG_like 478..570 CDD:214653 21/102 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.