DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and NCAM2

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens


Alignment Length:773 Identity:145/773 - (18%)
Similarity:261/773 - (33%) Gaps:256/773 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 CTTYTQPQNINAKSVQKPKPSERREVISTSSSSSHSWPSISAEPADEVVDHRGGGKPAKCAKNCQ 84
            ||...:|::|:..:.|..|      :|||                ..||..:.|.:......|..
Human    67 CTAIGEPESIDWYNPQGEK------IIST----------------QRVVVQKEGVRSRLTIYNAN 109

  Fly    85 -------KAKAKWAKWRTQ-----LKPHHQAHRAVQHKEARQRQRRETEEDELDAVLRAPSSTST 137
                   :.:|..||.:||     |    :.::.:..:|....|..:..|| .:.|.|..||.:.
Human   110 IEDAGIYRCQATDAKGQTQEATVVL----EIYQKLTFREVVSPQEFKQGED-AEVVCRVSSSPAP 169

  Fly   138 STA------VATTVQATSSSSSATRSSVINETKAKRPRSTLHLAPEDMQPKPKEPVIIIDDVEEF 196
            :.:      ..||:       |..|.::              ||..::|         |.::.:.
Human   170 AVSWLYHNEEVTTI-------SDNRFAM--------------LANNNLQ---------ILNINKS 204

  Fly   197 DSGTSTSDLIARKSREEAEEEEDEGPLEPRVLPLRPVPPNPYEAEEMSVVYAEQHSEIKLMCEVD 261
            |.|     :...:.|.||..|.|...    ::.:..|||.....::.....||:..|:...|...
Human   205 DEG-----IYRCEGRVEARGEIDFRD----IIVIVNVPPAISMPQKSFNATAERGEEMTFSCRAS 260

  Fly   262 LDIATSM-WYKNGQVVHAMDRTARVTDYRFIKEANGALTITNVMLEDDGKWQCEAENTRRYTENA 325
            .....:: |::||:::...::       ..:|.:|..||:.|::..|.|.:.|.|  |.:..|:.
Human   261 GSPEPAISWFRNGKLIEENEK-------YILKGSNTELTVRNIINSDGGPYVCRA--TNKAGEDE 316

  Fly   326 RPVKLVVLDRPKPPYLLIDSRRLDASNLFVPVK-----ENSELNLACVSEGGNPRPTLTWEVLLS 385
            :...|.|..:|.                .:.:|     ||.::.|.|.:| |.|.|.:||     
Human   317 KQAFLQVFVQPH----------------IIQLKNETTYENGQVTLVCDAE-GEPIPEITW----- 359

  Fly   386 PGVDRHAQKVSAEVLELEEIKGEKLDKDGYKINSGAKS-EARLPAVYRAHHNARILCVMEHPTLK 449
                                   |...||:....|.|| :.|:..  :..|.:..|.:.:   :|
Human   360 -----------------------KRAVDGFTFTEGDKSLDGRIEV--KGQHGSSSLHIKD---VK 396

  Fly   450 IRQNA---------------SLLLDVQYTPSFAISRTPGFGYPLREGIEVSLKCDVDSNPPSTPR 499
            :..:.               |:.||::|.|.|..::|..:.:   ||..:::.|||.||||::..
Human   397 LSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSW---EGNPINISCDVKSNPPASIH 458

  Fly   500 WQKDDGDTPVPQTGD---------GFLNFTSIRREHSGWYKCT-SRHLNFQYSSIGYYLSVRFDS 554
            |::|....|...|.:         ..|..........|.|.|| :.|:..::..  |.|::    
Human   459 WRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQE--YILAL---- 517

  Fly   555 VDVTSEPDDQDVSVAAASHNPNKGQLEVQLGGAVTLQCPQGSLGCWSHLDPISAR---------L 610
            .||.|.|  ..|.:...|....|          |:...|....|...|...:..:         :
Human   518 ADVPSSP--YGVKIIELSQTTAK----------VSFNKPDSHGGVPIHHYQVDVKEVASEIWKIV 570

  Fly   611 RGLG------YGSSQPTGQFSLKDVMYQDAGMYKCVGQSPTNKKKLEVLQSVTV------SVKGA 663
            |..|      ..:.:|...:.::.....        |:...:..|:|:.|::.|      |:.|.
Human   571 RSHGVQTMVVLNNLEPNTTYEIRVAAVN--------GKGQGDYSKIEIFQTLPVREPSPPSIHGQ 627

  Fly   664 PTVMALNATPVAYPGSPLHLNVEFCANPPAHAARWLHGDRVFTPGNQYGTTVLAYAVK 721
            |:           .|....|::                    |..:..|..:|.|.||
Human   628 PS-----------SGKSFKLSI--------------------TKQDDGGAPILEYIVK 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 19/88 (22%)
Ig strand B 254..258 CDD:409353 0/3 (0%)
Ig strand C 267..271 CDD:409353 1/4 (25%)
Ig strand E 296..300 CDD:409353 1/3 (33%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 0/2 (0%)
Ig 359..452 CDD:472250 20/93 (22%)
Ig_3 478..533 CDD:464046 16/63 (25%)
IG_like 578..660 CDD:214653 12/102 (12%)
NCAM2XP_011527877.1 IgI_1_NCAM-2 46..138 CDD:409452 19/96 (20%)
Ig strand A 46..51 CDD:409452
Ig strand A' 54..58 CDD:409452
Ig strand B 60..70 CDD:409452 2/2 (100%)
Ig strand C 74..80 CDD:409452 1/5 (20%)
Ig strand C' 83..85 CDD:409452 0/1 (0%)
Ig strand D 91..97 CDD:409452 2/5 (40%)
Ig strand E 99..107 CDD:409452 0/7 (0%)
Ig strand F 114..121 CDD:409452 0/6 (0%)
Ig strand G 126..137 CDD:409452 3/14 (21%)
Ig 142..218 CDD:472250 20/111 (18%)
Ig strand C 170..174 CDD:409353 0/3 (0%)
Ig strand E 193..197 CDD:409353 0/3 (0%)
IgI_1_MuSK 234..323 CDD:409562 20/97 (21%)
Ig strand A 234..237 CDD:409562 1/2 (50%)
Ig strand A' 242..247 CDD:409562 0/4 (0%)
Ig strand B 253..260 CDD:409562 1/6 (17%)
Ig strand C 266..271 CDD:409562 1/4 (25%)
Ig strand C' 273..275 CDD:409562 1/1 (100%)
Ig strand D 282..285 CDD:409562 0/2 (0%)
Ig strand E 289..295 CDD:409562 2/5 (40%)
Ig strand F 302..309 CDD:409562 3/8 (38%)
Ig strand G 315..323 CDD:409562 1/7 (14%)
IgI_NCAM-2 325..422 CDD:143278 24/146 (16%)
Ig strand A 325..330 CDD:143278 1/20 (5%)
Ig strand A' 334..338 CDD:143278 0/3 (0%)
Ig strand B 342..350 CDD:143278 2/7 (29%)
Ig strand C 356..362 CDD:143278 3/33 (9%)
Ig strand C' 365..368 CDD:143278 1/2 (50%)
Ig strand D 378..384 CDD:143278 1/7 (14%)
Ig strand E 387..393 CDD:143278 1/5 (20%)
Ig strand F 401..409 CDD:143278 0/7 (0%)
Ig strand G 412..422 CDD:143278 2/9 (22%)
Ig_3 426..504 CDD:464046 21/80 (26%)
FN3 521..613 CDD:238020 15/111 (14%)
fn3 619..703 CDD:394996 11/67 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.