DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and Cadm2

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:XP_038944379.1 Gene:Cadm2 / 360687 RGDID:1305678 Length:444 Species:Rattus norvegicus


Alignment Length:379 Identity:90/379 - (23%)
Similarity:153/379 - (40%) Gaps:88/379 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 LMCEVDLDIATSMWYKN--GQVVHAMDRTARVTDYRF-IKEANG---ALTITNVMLEDDGKWQCE 314
            |.|.||.:..||:.:.|  .|.::..|:.| :.|.|. :..|:.   ::::::|.|.|:|::.|.
  Rat    51 LTCRVDQNDNTSLQWSNPAQQTLYFDDKKA-LRDNRIELVRASWHELSISVSDVSLSDEGQYTCS 114

  Fly   315 AENTRRYTENARPVK-----LVVLDRPKPPYLLIDSRRLDASNLFVPVKENSELNLACVSEGGNP 374
            .     :|   .|||     |.||..|:.|.:         |....||.|...:.|.|.:.|..|
  Rat   115 L-----FT---MPVKTSKAYLTVLGVPEKPQI---------SGFSSPVMEGDLMQLTCKTSGSKP 162

  Fly   375 RPTLTWEVLLSPGVDRHAQKVSAEVLELEEIKGEKLDKDGYKINSGAKSEARLPAVYRAHHNARI 439
            ...:.|            .|...|:.:::.:|.|..::..:.::|.....     |.|:.....:
  Rat   163 AADIRW------------FKNDKEIKDVKYLKEEDANRKTFTVSSTLDFR-----VDRSDDGVAV 210

  Fly   440 LCVMEHPTLKIR-QNASLLLDVQYTPSFAISRTPGFGYPLREGIEVSLKCDVDSNP-PSTPRWQK 502
            :|.::|.:|... |.|..:|::.||||..|  .|...:| :||..::|.|:....| |....|.|
  Rat   211 ICRVDHESLNATPQVAMQVLEI
HYTPSVKI--IPSTPFP-QEGQALTLTCESKGKPLPEPVLWTK 272

  Fly   503 DDGDTPVPQ---TGDGFLNFTSIRREHSGWYKCTSRHLNFQYSSIGYYLSVR------------- 551
            |..:.|.|.   .....||...:.:..:|.|:|.:.:...| ||..|.|.|.             
  Rat   273 DGAELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQ-SSAEYVLIVHDVPNTLLPTTIIP 336

  Fly   552 -------FDSVDVTSEPDDQDVSVAAAS---HNPN-----KGQLEVQLGGAVTL 590
                   ..:|.:|:.|     |.:|:|   .:||     .|.....:||.|.:
  Rat   337 SLTTAPVTTTVAITTSP-----STSASSSSRRDPNSLAGQNGPDHALIGGIVAV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 23/86 (27%)
Ig strand B 254..258 CDD:409353 1/1 (100%)
Ig strand C 267..271 CDD:409353 1/3 (33%)
Ig strand E 296..300 CDD:409353 0/6 (0%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 1/2 (50%)
Ig 359..452 CDD:472250 16/93 (17%)
Ig_3 478..533 CDD:464046 15/58 (26%)
IG_like 578..660 CDD:214653 4/13 (31%)
Cadm2XP_038944379.1 IgV_1_Necl-3 35..130 CDD:409498 23/87 (26%)
Ig strand A 35..38 CDD:409498
FR1 36..54 CDD:409498 1/2 (50%)
Ig strand A' 39..45 CDD:409498
Ig strand B 47..55 CDD:409498 2/3 (67%)
CDR1 55..60 CDD:409498 2/4 (50%)
FR2 61..68 CDD:409498 2/6 (33%)
Ig strand C 61..67 CDD:409498 2/5 (40%)
CDR2 69..80 CDD:409498 2/10 (20%)
Ig strand C' 71..75 CDD:409498 1/3 (33%)
Ig strand C' 77..80 CDD:409498 1/2 (50%)
FR3 81..116 CDD:409498 8/39 (21%)
Ig strand D 85..92 CDD:409498 1/6 (17%)
Ig strand E 95..101 CDD:409498 0/5 (0%)
Ig strand F 108..116 CDD:409498 2/12 (17%)
CDR3 117..120 CDD:409498 1/5 (20%)
Ig strand G 120..130 CDD:409498 3/9 (33%)
FR4 122..129 CDD:409498 1/6 (17%)
IgI_2_Necl-3 129..232 CDD:409467 26/128 (20%)
Ig strand A 130..133 CDD:409467 1/2 (50%)
Ig strand A' 136..140 CDD:409467 1/12 (8%)
Ig strand B 149..159 CDD:409467 2/9 (22%)
Ig strand C 162..171 CDD:409467 2/20 (10%)
Ig strand C' 172..175 CDD:409467 0/2 (0%)
Ig strand D 177..184 CDD:409467 1/6 (17%)
Ig strand E 190..200 CDD:409467 1/9 (11%)
Ig strand F 208..216 CDD:409467 1/7 (14%)
Ig strand G 224..231 CDD:409467 2/6 (33%)
Ig_3 236..309 CDD:464046 21/75 (28%)
4.1m 397..415 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.