DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17716 and ed

DIOPT Version :9

Sequence 1:NP_001286391.1 Gene:CG17716 / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster


Alignment Length:524 Identity:119/524 - (22%)
Similarity:177/524 - (33%) Gaps:182/524 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 LTITNVML-EDDGKWQC--EAENT----RRYTENARPVKLVVLDRPKPPYLLIDSRRLDASNLFV 355
            |.|.||.. .|:|:::|  :|:.|    .:...|     |.||..|.||.       :...|:.|
  Fly   110 LQIKNVSYNRDNGRFECRIKAKGTGADVHQEFHN-----LTVLTPPHPPV-------ISPGNIAV 162

  Fly   356 PVKENSELNLACVSEGGNPRPTLTW----------EVLLSPGVDRHAQKVSAEVLELEEIKGEKL 410
             ..|:..:.|.|.|.||:|.||:||          ..:|..|........:..::...|..|.| 
  Fly   163 -ATEDKPMELTCSSIGGSPDPTITWYREGSNTPLPATVLKGGTKDQPTNATLSIIPRREDDGAK- 225

  Fly   411 DKDGYK-------INSGAKSEA--------------------------------------RLPAV 430
                ||       :|.|.:.||                                      ::|.|
  Fly   226 ----YKCVVRNRAMNEGKRLEATATLNVNYYPRVEVGPENPLRVERDRTAKLECNVDAKPKVPNV 286

  Fly   431 YRAHHNARIL--------------------CVMEHPTLKIRQNASLLLDVQYTPSFAI-SRTPGF 474
             |.:.|.|.:                    |:.::...|..:. .|:||:.|.|...| |:|   
  Fly   287 -RWNRNGRFISSSLVHTIHRVSVQDAGKYTCIADNGLGKTGEQ-ELILDILYPPMVVIESKT--- 346

  Fly   475 GYPLREGIEVSLKCDVDSNP-PSTPRWQKDDGDTPVPQTGDGFLNFTSIRREHSGWYKCTSRHLN 538
             ....||..|:::|:|.:|| |.|..|.|:  ::|..:.....|..||:|.:|:|.|.|  |.:|
  Fly   347 -REAEEGDTVTIRCNVTANPAPVTIEWLKE--NSPDFRYNGDVLTLTSVRADHAGNYIC--RAVN 406

  Fly   539 FQYSSIGYYLSVRFDSVDVTSEPDDQDVSVAAASHNPNKGQLE-----VQLGGAVTLQCPQGSLG 598
            ...|. |...|.|..:..|          .....|.|.:..:.     |.:|..|||.|.....|
  Fly   407 IMQSQ-GMERSERVGNSTV----------ALLVRHRPGQAYITPNKPVVHVGNGVTLTCSANPPG 460

  Fly   599 CWSHLDPI-------------SARLRGLGYGSSQPTGQFSLKDVMYQDAGMYKC----------- 639
             |    |:             |:..:.|..|.     |:|:......:.|.|.|           
  Fly   461 -W----PVPQYRWFRDMDGEFSSTQKILAQGP-----QYSIPKAHLGNEGKYHCHAVNELGIGMM 515

  Fly   640 ------VGQSPTNKKKL---------EVLQSVTVSVKG--APTVMALNATPVAYPGSPLHLNVEF 687
                  :.|.|....||         :...:||.|.||  ||:|..|.......|...|:   |.
  Fly   516 ATIVLEIHQPPQFLAKLQQHMTRRVADTDYTVTCSAKGKPAPSVKWLKDAVEILPEENLY---EV 577

  Fly   688 CANP 691
            ..||
  Fly   578 QTNP 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17716NP_001286391.1 IG_like 244..332 CDD:214653 11/40 (28%)
Ig 254..323 CDD:143165 9/31 (29%)
Ig 359..452 CDD:299845 29/167 (17%)
Ig_3 477..536 CDD:290638 20/59 (34%)
IG_like 479..550 CDD:214653 24/71 (34%)
IG_like 578..660 CDD:214653 23/125 (18%)
edNP_001260013.1 Ig 50..147 CDD:299845 11/41 (27%)
I-set 146..249 CDD:254352 29/115 (25%)
Ig 168..249 CDD:299845 21/85 (25%)
IGc2 268..323 CDD:197706 6/55 (11%)
Ig_3 341..406 CDD:290638 24/72 (33%)
Ig_2 437..514 CDD:290606 17/86 (20%)
I-set 526..633 CDD:254352 17/59 (29%)
Ig 546..632 CDD:143165 14/39 (36%)
IG_like 654..736 CDD:214653
Ig 656..734 CDD:143165
FN3 741..848 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.