DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and alcama

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_571075.1 Gene:alcama / 30194 ZFINID:ZDB-GENE-990415-30 Length:564 Species:Danio rerio


Alignment Length:434 Identity:99/434 - (22%)
Similarity:155/434 - (35%) Gaps:113/434 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 DIATSMWYKNGQVVHAMD--RTARVTDYRFIKEANGALTITNVMLEDDGKWQCEAENTRRYTENA 325
            |:......|:...|.|||  :|      |....||.:|.|....|.|...:.|...::....|.:
Zfish    64 DLLIKQAQKDDPTVSAMDGYKT------RVSIAANSSLLIAQGSLTDQRVFTCMVVSSTNLEEFS 122

  Fly   326 RPVKLVVLDRPKPPYLLIDSRRLDASNLFVPVKENSELNL--ACVSEGGNPRPTLTW----EVLL 384
            ..||  |..:|..|.:....:.|          ||.:|..  .||.|..||...|.|    :.|:
Zfish   123 VEVK--VHKKPSAPVIKNKVKEL----------ENGKLTQLGECVVESANPAADLIWMKNNQALV 175

  Fly   385 SPGVDRHAQKVSAEVLELEEIKGEKLDKDGYKINSGAKSEARLPAVYRAHHNA-RILCVMEHPTL 448
            ..|         ..::...::     .||  .:...:.:.:||....|....| :..||.:|.|.
Zfish   176 DDG---------KTIIITSDV-----TKD--PVTGLSSTSSRLQYTARKEDVASQFTCVAKHVTG 224

  Fly   449 KIRQNASLLLDVQYTPSFAISRTPGFGYPLREGIEVSLKCDVDSNPPSTP-----RWQKDDGDTP 508
            ..:.:......::| |:..:|.......|:|||.:|:|||..|.|||.|.     :.:|      
Zfish   225 PNQVSTPDTFQIRY-PTEKVSLQVVSQSPIREGDDVTLKCQADGNPPPTSFNFNIKGKK------ 282

  Fly   509 VPQTGDGFLNFTSIRREHSGWYKCTSRHLNFQYSSIGYYLSVRFDSVDVTSEPDDQDVSVAAASH 573
            |..|.......|.:.|..||.|||:                 ..|: ||........||...||.
Zfish   283 VTVTDKDVYTLTGVTRADSGVYKCS-----------------LLDN-DVMESTQIVTVSFLDASL 329

  Fly   574 NPNKGQLEVQLGGAVTLQCPQGSLG----CWS----HLD--PISARLRGLGYGSSQPTGQFSLKD 628
            .|. |::..:||..:.:...:.:..    .|:    .||  |..::||                 
Zfish   330 TPT-GKVLKKLGENLVVSLEKNASSEVKVTWTKDNRKLDKLPDFSQLR----------------- 376

  Fly   629 VMYQDAGMYKCVGQSPTNKKKLEVLQ---SVTVSVKGAPTVMAL 669
              |.|||:|.|       ...:|.::   |..::|:|.|.:..|
Zfish   377 --YSDAGLYVC-------DVSIEGIKHSFSFELTVEGGPRITGL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 18/70 (26%)
Ig strand B 254..258 CDD:409353
Ig strand C 267..271 CDD:409353 0/3 (0%)
Ig strand E 296..300 CDD:409353 1/3 (33%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 0/2 (0%)
Ig 359..452 CDD:472250 22/99 (22%)
Ig_3 478..533 CDD:464046 21/59 (36%)
IG_like 578..660 CDD:214653 17/94 (18%)
alcamaNP_571075.1 Ig 134..221 CDD:472250 22/112 (20%)
Ig strand E 200..204 CDD:409353 2/3 (67%)
Ig strand F 214..219 CDD:409353 1/4 (25%)
IG_like 254..322 CDD:214653 25/91 (27%)
Ig strand B 259..263 CDD:409353 2/3 (67%)
Ig strand C 272..275 CDD:409353 1/2 (50%)
Ig strand E 292..296 CDD:409353 1/3 (33%)
Ig strand F 303..308 CDD:409353 3/21 (14%)
Ig strand G 318..321 CDD:409353 0/2 (0%)
IG_like 333..402 CDD:214653 17/94 (18%)
Ig 406..>439 CDD:472250 2/6 (33%)
Ig strand B 422..426 CDD:409353
Ig <424..477 CDD:472250
Ig strand C 435..439 CDD:409353
Ig strand C 435..439 CDD:409353
Ig strand E 453..457 CDD:409353
Ig strand F 467..472 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 539..564
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.