DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and Ncam2

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_981954.2 Gene:Ncam2 / 288280 RGDID:1303131 Length:837 Species:Rattus norvegicus


Alignment Length:655 Identity:129/655 - (19%)
Similarity:230/655 - (35%) Gaps:198/655 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 QATSSSSSATRSSVINETKAKRPRSTLHLAPEDMQ--------------PKP-------KEPVII 189
            |||.:......::|:.|...|.....: |:|::.:              |.|       .|.|..
  Rat    94 QATDAKGQTQEATVVLEIYQKLTFREV-LSPQEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTT 157

  Fly   190 IDD----------VEEFDSGTSTSDLIARKSREEAEEEEDEGPLEPRVLPLRPVPPNPYEAEEMS 244
            |.|          ::..:...|...:...:.|.||..|.|...    ::.:..|||.....::..
  Rat   158 IPDNRFAVLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRD----IIVIVNVPPAIVMPQKSF 218

  Fly   245 VVYAEQHSEIKLMCEV--DLDIATSMWYKNGQVVHAMDRTARVTDYRFIKEANGALTITNVMLED 307
            ...||:..|:.|.|:.  ..|.|.| |::||:::...::       ..:|.:|..||:.|::.:|
  Rat   219 NATAERGEEMTLTCKASGSPDPAIS-WFRNGKLIEENEK-------YILKGSNTELTVRNIINKD 275

  Fly   308 DGKWQCEAENTRRYTENARPVKLVVLDRPKPPYLLIDSRRLDASNLFVPVKENSELNLACVSEGG 372
            .|.:.|:|  |.:..|:.:...|.|..:|....|..::           ..||..:.|.|.:| |
  Rat   276 GGSYVCKA--TNKAGEDQKQAFLQVFVQPHILQLKNET-----------TSENGHVTLICEAE-G 326

  Fly   373 NPRPTLTWE-----VLLSPGVDRHAQKVSAEVLELEEIKGE----KLDKDGYKINSGAKSEARLP 428
            .|.|.:||:     |..|.|......::        |:||:    .|.....|::...:.:....
  Rat   327 EPVPEITWKRAIDGVTFSEGDKSPDGRI--------EVKGQHGRSSLHIRDVKLSDSGRYDCEAA 383

  Fly   429 AVYRAHHNARILCVMEHPTLKIRQNASLLLDVQYTPSFAISRTPGFGYPLREGIEVSLKCDVDSN 493
            :....|..                  |:.||::|.|.|..::|..:.:   ||..:::.|||.:|
  Rat   384 SRIGGHQR------------------SMHLDIEYAPKFVSNQTMYYSW---EGNPINISCDVKAN 427

  Fly   494 PPSTPRWQKDDGDTPVPQTGDGFLNFTSIRRE-----------HSGWYKCTSRH---LNFQYSSI 544
            ||::..|:::....|...|  ..|...|:.|:           ..|.|.||:.:   ..||    
  Rat   428 PPASIHWRREKLVLPAKNT--THLKTHSVGRKMILEIAPTSDNDFGRYNCTATNRIGTRFQ---- 486

  Fly   545 GYYLSVRFDSVDVTSEPDDQDVSVAAASHNPNKGQLEVQLGGAVTLQCPQGSLGCWSHLDPISAR 609
            .|.|.:    .||.|.|  :.|.:...|....|          ::...|:...|...|...:..:
  Rat   487 EYILEL----ADVPSSP--RGVKIIELSQTTAK----------ISFNKPESHGGVPIHHYQVDVK 535

  Fly   610 ---------LRGLG------YGSSQPTGQFSLKDVMYQDAGMYKCVGQSPTNKKKLEVLQSVTVS 659
                     :|..|      ..|.:|...:.::.....        |:...:..|:|:.|::   
  Rat   536 EVTSETWKIVRSHGVQTTVVLSSLEPNTTYEVRVAAVN--------GKGQGDYSKIEIFQTL--- 589

  Fly   660 VKGAPTVMALNATPVAYPGSPLHLNVEFCANPPAHAARWLHGD----RVF----TPGNQYGTTVL 716
                         ||..|            :||:     :||.    :.|    |..:..|..:|
  Rat   590 -------------PVREP------------SPPS-----IHGQPSSGKSFKISITKQDDGGAPIL 624

  Fly   717 AYAVK 721
            .|.||
  Rat   625 EYIVK 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 23/89 (26%)
Ig strand B 254..258 CDD:409353 1/3 (33%)
Ig strand C 267..271 CDD:409353 2/3 (67%)
Ig strand E 296..300 CDD:409353 1/3 (33%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 0/2 (0%)
Ig 359..452 CDD:472250 19/101 (19%)
Ig_3 478..533 CDD:464046 16/65 (25%)
IG_like 578..660 CDD:214653 11/96 (11%)
Ncam2NP_981954.2 IgI_1_NCAM-2 21..113 CDD:409452 5/18 (28%)
Ig strand A 21..26 CDD:409452
Ig strand A' 29..33 CDD:409452
Ig strand B 35..45 CDD:409452
Ig strand C 49..55 CDD:409452
Ig strand C' 58..60 CDD:409452
Ig strand D 66..72 CDD:409452
Ig strand E 74..82 CDD:409452
Ig strand F 89..96 CDD:409452 1/1 (100%)
Ig strand G 101..112 CDD:409452 2/10 (20%)
Ig 117..193 CDD:472250 11/76 (14%)
Ig strand B 132..136 CDD:409353 0/3 (0%)
Ig strand C 145..152 CDD:409353 0/6 (0%)
Ig strand E 169..173 CDD:409353 0/3 (0%)
Ig strand F 183..187 CDD:409353 0/3 (0%)
Ig strand G 191..194 CDD:409353 2/2 (100%)
IgI_1_MuSK 209..298 CDD:409562 24/98 (24%)
Ig strand A 209..212 CDD:409562 1/2 (50%)
Ig strand A' 217..222 CDD:409562 0/4 (0%)
Ig strand B 228..235 CDD:409562 2/6 (33%)
Ig strand C 241..246 CDD:409562 3/5 (60%)
Ig strand C' 248..250 CDD:409562 1/1 (100%)
Ig strand D 257..260 CDD:409562 0/2 (0%)
Ig strand E 264..270 CDD:409562 2/5 (40%)
Ig strand F 277..284 CDD:409562 3/8 (38%)
Ig strand G 290..298 CDD:409562 1/7 (14%)
Ig 300..397 CDD:472250 23/134 (17%)
Ig strand B 318..322 CDD:409353 1/3 (33%)
Ig strand C 331..335 CDD:409353 1/3 (33%)
Ig strand E 363..367 CDD:409353 1/3 (33%)
Ig strand F 377..382 CDD:409353 0/4 (0%)
Ig strand G 390..393 CDD:409353 0/20 (0%)
Ig_3 401..479 CDD:464046 21/82 (26%)
FN3 496..588 CDD:238020 15/111 (14%)
fn3 594..678 CDD:394996 12/53 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.