DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and Cntn2

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_037016.2 Gene:Cntn2 / 25356 RGDID:3821 Length:1040 Species:Rattus norvegicus


Alignment Length:393 Identity:103/393 - (26%)
Similarity:151/393 - (38%) Gaps:93/393 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 ANGALTITNVMLEDDGKWQCEAENTR-RYTENARPVKLVVLDRPKPPYL-LIDSRRLDASNLFVP 356
            |...|.|.:|..||:|.::|||||:: |.|...|     ::.:.:|.:| :|.....|.      
  Rat   289 AEPTLQIPSVSFEDEGTYECEAENSKGRDTVQGR-----IIVQAQPEWLKVISDTEADI------ 342

  Fly   357 VKENSELNLACVSEGGNPRPTLTWEVLLSPGVDRHAQKVSAEVLELEEIKGEKLDKDGYKINSGA 421
               .|.|...|.: .|.|||.:.|.....|...::..:|.|..|...::..|         :|| 
  Rat   343 ---GSNLRWGCAA-AGKPRPMVRWLRNGEPLASQNRVEVLAGDLRFSKLSLE---------DSG- 393

  Fly   422 KSEARLPAVYRAHHNARILCVME--HPTLKIRQNASLLLDVQ-YTPSF---AISRTPGFGYPLRE 480
                    :|:        ||.|  |.|:    .||..|.|| ..|.|   .:.|.    .|...
  Rat   394 --------MYQ--------CVAENKHGTI----YASAELAVQALAPDFRQNPVRRL----IPAAR 434

  Fly   481 GIEVSLKCDVDSNPPSTPRWQKD----DGDTPVPQTGDGFLNFTSIRREHSGWYKCTSRHLNFQY 541
            |.|:|:.|...:.|.:|..|.|.    ...|.|..|.||.|...:|.|...|.|.|.:.:...:.
  Rat   435 GGEISILCQPRAAPKATILWSKGTEILGNSTRVTVTSDGTLIIRNISRSDEGKYTCFAENFMGKA 499

  Fly   542 SSIGYYLSVRFDSVDVTSEPDDQDVSVAAASHNPNKGQLEVQLGGAVTLQC-----PQGSLGCWS 601
            :|.| .|||| |:..:|..|...|::|                |..:||||     |...|....
  Rat   500 NSTG-ILSVR-DATKITLAPSSADINV----------------GDNLTLQCHASHDPTMDLTFTW 546

  Fly   602 HLD--PISARLRGLGY---GSSQPTGQFSLKDVMYQDAGMYKCVGQSPTNKKKLEVLQSVTVSVK 661
            .||  ||.....|..|   .:.:..|..::.:...:..|.|.|:.|:..:....|    .||.|:
  Rat   547 TLDDFPIDFDKPGGHYRRASAKETIGDLTILNAQLRHGGKYTCMAQTVVDGTSKE----ATVLVR 607

  Fly   662 GAP 664
            |.|
  Rat   608 GPP 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 15/38 (39%)
Ig strand B 254..258 CDD:409353
Ig strand C 267..271 CDD:409353
Ig strand E 296..300 CDD:409353 1/3 (33%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 1/2 (50%)
Ig 359..452 CDD:472250 21/94 (22%)
Ig_3 478..533 CDD:464046 18/58 (31%)
IG_like 578..660 CDD:214653 21/91 (23%)
Cntn2NP_037016.2 Ig 37..133 CDD:472250
Ig strand B 59..63 CDD:409353
Ig strand C 72..76 CDD:409353
Ig strand E 95..99 CDD:409353
Ig strand F 110..115 CDD:409353
Ig strand G 124..127 CDD:409353
Ig2_Contactin-2-like 141..230 CDD:409392
Ig strand A 143..148 CDD:409392
Ig strand B 152..158 CDD:409392
Ig strand C 166..172 CDD:409392
Ig strand C' 177..179 CDD:409392
Ig strand D 184..189 CDD:409392
Ig strand E 192..196 CDD:409392
Ig strand F 206..214 CDD:409392
Ig strand G 218..230 CDD:409392
Ig 241..326 CDD:472250 15/41 (37%)
Ig strand B 259..263 CDD:409353
Ig strand C 272..276 CDD:409353
Ig strand E 291..295 CDD:409353 1/3 (33%)
Ig strand F 305..310 CDD:409353 1/4 (25%)
Ig strand G 318..321 CDD:409353 1/2 (50%)
Ig4_Contactin-2-like 330..414 CDD:143205 27/123 (22%)
Ig strand A 330..333 CDD:143205 0/2 (0%)
Ig strand A' 337..341 CDD:143205 0/3 (0%)
Ig strand B 345..353 CDD:143205 2/8 (25%)
Ig strand C 359..364 CDD:143205 1/4 (25%)
Ig strand C' 366..369 CDD:143205 0/2 (0%)
Ig strand D 374..378 CDD:143205 0/3 (0%)
Ig strand E 380..385 CDD:143205 1/4 (25%)
Ig strand F 394..401 CDD:143205 3/14 (21%)
Ig strand G 405..414 CDD:143205 4/12 (33%)
Ig5_Contactin 419..507 CDD:409358 26/92 (28%)
Ig strand A 419..424 CDD:409358 2/4 (50%)
Ig strand A' 427..432 CDD:409358 1/8 (13%)
Ig strand B 436..443 CDD:409358 2/6 (33%)
Ig strand C 451..455 CDD:409358 1/3 (33%)
Ig strand D 469..472 CDD:409358 1/2 (50%)
Ig strand E 473..478 CDD:409358 2/4 (50%)
Ig strand F 486..494 CDD:409358 3/7 (43%)
Ig strand G 500..507 CDD:409358 3/7 (43%)
Ig 509..605 CDD:472250 25/115 (22%)
Ig strand B 528..532 CDD:409353 2/3 (67%)
Ig strand C 543..547 CDD:409353 0/3 (0%)
Ig strand E 572..576 CDD:409353 1/3 (33%)
Ig strand F 586..591 CDD:409353 2/4 (50%)
Ig strand G 599..602 CDD:409353 1/6 (17%)
FN3 620..707 CDD:238020
FN3 728..802 CDD:238020
Cell attachment site. /evidence=ECO:0000255 796..798
FN3 817..909 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 895..921
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.