DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and CADM2

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:XP_016861551.1 Gene:CADM2 / 253559 HGNCID:29849 Length:449 Species:Homo sapiens


Alignment Length:376 Identity:88/376 - (23%)
Similarity:151/376 - (40%) Gaps:82/376 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 LMCEVDLDIATSMWYKN--GQVVHAMDRTARVTDYRF-IKEANG---ALTITNVMLEDDGKWQCE 314
            |.|.||.:..||:.:.|  .|.::..|:.| :.|.|. :..|:.   ::::::|.|.|:|::.|.
Human    56 LTCRVDQNDNTSLQWSNPAQQTLYFDDKKA-LRDNRIELVRASWHELSISVSDVSLSDEGQYTCS 119

  Fly   315 AENTRRYTENARPVK-----LVVLDRPKPPYLLIDSRRLDASNLFVPVKENSELNLACVSEGGNP 374
            .     :|   .|||     |.||..|:.|.:         |....||.|...:.|.|.:.|..|
Human   120 L-----FT---MPVKTSKAYLTVLGVPEKPQI---------SGFSSPVMEGDLMQLTCKTSGSKP 167

  Fly   375 RPTLTWEVLLSPGVDRHAQKVSAEVLELEEIKGEKLDKDGYKINSGAKSEARLPAVYRAHHNARI 439
            ...:.|            .|...|:.:::.:|.|..::..:.::|.....     |.|:.....:
Human   168 AADIRW------------FKNDKEIKDVKYLKEEDANRKTFTVSSTLDFR-----VDRSDDGVAV 215

  Fly   440 LCVMEHPTLKIR-QNASLLLDVQYTPSFAISRTPGFGYPLREGIEVSLKCDVDSNP-PSTPRWQK 502
            :|.::|.:|... |.|..:|::.||||..|  .|...:| :||..:.|.|:....| |....|.|
Human   216 ICRVDHESLNATPQVAMQVLEI
HYTPSVKI--IPSTPFP-QEGQPLILTCESKGKPLPEPVLWTK 277

  Fly   503 DDGDTPVPQ---TGDGFLNFTSIRREHSGWYKCTSRHLNFQYSSIGYYLSVR------------- 551
            |.|:.|.|.   .....||...:.:..:|.|:|.:.:...| ||..|.|.|.             
Human   278 DGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQ-SSAEYVLIVHDVPNTLLPTTIIP 341

  Fly   552 -------FDSVDVTSEPDDQDVSVAAASHNPN-----KGQLEVQLGGAVTL 590
                   ..:|.:|:.|...  :..::..:||     .|.....:||.|.:
Human   342 SLTTATVTTTVAITTSPTTS--ATTSSIRDPNALAGQNGPDHALIGGIVAV 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 23/86 (27%)
Ig strand B 254..258 CDD:409353 1/1 (100%)
Ig strand C 267..271 CDD:409353 1/3 (33%)
Ig strand E 296..300 CDD:409353 0/6 (0%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 1/2 (50%)
Ig 359..452 CDD:472250 16/93 (17%)
Ig_3 478..533 CDD:464046 16/58 (28%)
IG_like 578..660 CDD:214653 4/13 (31%)
CADM2XP_016861551.1 IgV_1_Necl-3 40..135 CDD:409498 23/87 (26%)
Ig strand A 40..43 CDD:409498
FR1 41..59 CDD:409498 1/2 (50%)
Ig strand A' 44..50 CDD:409498
Ig strand B 52..60 CDD:409498 2/3 (67%)
CDR1 60..65 CDD:409498 2/4 (50%)
FR2 66..73 CDD:409498 2/6 (33%)
Ig strand C 66..72 CDD:409498 2/5 (40%)
CDR2 74..85 CDD:409498 2/10 (20%)
Ig strand C' 76..80 CDD:409498 1/3 (33%)
Ig strand C' 82..85 CDD:409498 1/2 (50%)
FR3 86..121 CDD:409498 8/39 (21%)
Ig strand D 90..97 CDD:409498 1/6 (17%)
Ig strand E 100..106 CDD:409498 0/5 (0%)
Ig strand F 113..121 CDD:409498 2/12 (17%)
CDR3 122..125 CDD:409498 1/5 (20%)
Ig strand G 125..135 CDD:409498 3/9 (33%)
FR4 127..134 CDD:409498 1/6 (17%)
IgI_2_Necl-3 134..237 CDD:409467 26/128 (20%)
Ig strand A 135..138 CDD:409467 1/2 (50%)
Ig strand A' 141..145 CDD:409467 1/12 (8%)
Ig strand B 154..164 CDD:409467 2/9 (22%)
Ig strand C 167..176 CDD:409467 2/20 (10%)
Ig strand C' 177..180 CDD:409467 0/2 (0%)
Ig strand D 182..189 CDD:409467 1/6 (17%)
Ig strand E 195..205 CDD:409467 1/9 (11%)
Ig strand F 213..221 CDD:409467 1/7 (14%)
Ig strand G 229..236 CDD:409467 2/6 (33%)
Ig_3 241..314 CDD:464046 22/75 (29%)
4.1m 402..420 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.