DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and Pvr

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_058772.2 Gene:Pvr / 25066 RGDID:3813 Length:412 Species:Rattus norvegicus


Alignment Length:322 Identity:72/322 - (22%)
Similarity:118/322 - (36%) Gaps:99/322 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 NGALTITNVMLEDDGKWQCEAENTRRYTENARPVKLVVLDRPKPPYLLIDSRRLDASNLFVPVKE 359
            |.:|.|:|:.:||:|.::|:.......:::|. |.|.|..|||.     .:..|:.|...:|   
  Rat   112 NASLAISNLRVEDEGIYECQIATFPTGSKSAN-VWLKV
FARPKN-----TAEALEPSPTLMP--- 167

  Fly   360 NSELNLA-CVSEGGNPRPTLTWEVLLSPGVDRHAQKVSAEVLELEEIKGEKLDKDGYKINSGAKS 423
               .::| |:|..|:|...:||           :..|:....|::|              :|::.
  Rat   168 ---QDVAKCISADGHPPGRITW-----------SSNVNGSYREMKE--------------TGSQP 204

  Fly   424 EARLPAVYRA------HHNARILCVMEHPTLKIRQNASLLLDVQYTPSFAISRTPGFGYPLREG- 481
            .......|.:      .....|.|.:||.:.:......|:|.:.|.|..:||     ||   || 
  Rat   205 GTTTVISYLSMVPSSQADGTNITCTVEHESFQEPDQQPLILSLP
YPPEVSIS-----GY---EGN 261

  Fly   482 -----IEVSLKCDVDSNPPSTP-RWQKDDGDTPVPQTGDGFLNFTSIRREHSGWYKCTSRHLNFQ 540
                 ..|:|.|:..|.||.|. .|....|  |:|       |.|..:...|        ||   
  Rat   262 WYIGLTNVNLTCEARSKPPPTNYSWSTATG--PLP-------NSTHFQENGS--------HL--- 306

  Fly   541 YSSIGYYLSVRFDSVDVTSEPDDQD----VSVAAASHNPNKGQLEVQLGGAVTLQCPQGSLG 598
                            :.|..||.:    |..|..:....:||:.:.:..|..:..|:.|||
  Rat   307 ----------------LISTVDDLNNTIFVCKAINALGSGQGQVTILVKEASEILPPKTSLG 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 11/36 (31%)
Ig strand B 254..258 CDD:409353
Ig strand C 267..271 CDD:409353
Ig strand E 296..300 CDD:409353 1/3 (33%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 0/2 (0%)
Ig 359..452 CDD:472250 16/99 (16%)
Ig_3 478..533 CDD:464046 16/61 (26%)
IG_like 578..660 CDD:214653 7/21 (33%)
PvrNP_058772.2 Ig 35..148 CDD:472250 11/36 (31%)
Ig strand B 51..55 CDD:409353
Ig strand C 67..71 CDD:409353
Ig strand E 113..117 CDD:409353 1/3 (33%)
Ig strand F 127..132 CDD:409353 1/4 (25%)
Ig strand G 141..144 CDD:409353 1/3 (33%)
IgC1_2_Nectin-2_Necl-5_like 152..248 CDD:409500 23/131 (18%)
Ig strand A 152..158 CDD:409500 2/10 (20%)
Ig strand B 169..176 CDD:409500 2/6 (33%)
Ig strand C 181..187 CDD:409500 2/16 (13%)
Ig strand C' 189..191 CDD:409500 0/1 (0%)
Ig strand D 194..202 CDD:409500 2/21 (10%)
Ig strand E 207..215 CDD:409500 1/7 (14%)
Ig strand F 225..232 CDD:409500 2/6 (33%)
Ig strand G 238..244 CDD:409500 0/5 (0%)
Ig 251..338 CDD:472250 30/130 (23%)
Ig strand B 269..273 CDD:409353 2/3 (67%)
Ig strand C 283..287 CDD:409353 0/3 (0%)
Ig strand E 304..308 CDD:409353 3/30 (10%)
Ig strand F 318..323 CDD:409353 1/4 (25%)
Ig strand G 333..336 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.