DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and Cadm2

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:XP_011244430.1 Gene:Cadm2 / 239857 MGIID:2442722 Length:458 Species:Mus musculus


Alignment Length:379 Identity:91/379 - (24%)
Similarity:153/379 - (40%) Gaps:88/379 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 LMCEVDLDIATSMWYKN--GQVVHAMDRTARVTDYRF-IKEANG---ALTITNVMLEDDGKWQCE 314
            |.|.||.:..||:.:.|  .|.::..|:.| :.|.|. :..|:.   ::::::|.|.|:|::.|.
Mouse    65 LTCRVDQNDNTSLQWSNPAQQTLYFDDKKA-LRDNRIELVRASWHELSISVSDVSLSDEGQYTCS 128

  Fly   315 AENTRRYTENARPVK-----LVVLDRPKPPYLLIDSRRLDASNLFVPVKENSELNLACVSEGGNP 374
            .     :|   .|||     |.||..|:.|.:         |....||.|...:.|.|.:.|..|
Mouse   129 L-----FT---MPVKTSKAYLTVLGVPEKPQI---------SGFSSPVMEGDLMQLTCKTSGSKP 176

  Fly   375 RPTLTWEVLLSPGVDRHAQKVSAEVLELEEIKGEKLDKDGYKINSGAKSEARLPAVYRAHHNARI 439
            ...:.|            .|...|:.:::.:|.|..::..:.::|.....     |.|:.....:
Mouse   177 AADIRW------------FKNDKEIKDVKYLKEEDANRKTFTVSSTLDFR-----VDRSDDGVAV 224

  Fly   440 LCVMEHPTLKIR-QNASLLLDVQYTPSFAISRTPGFGYPLREGIEVSLKCDVDSNP-PSTPRWQK 502
            :|.::|.:|... |.|..:|::.||||..|  .|...:| :||..::|.|:....| |....|.|
Mouse   225 ICRVDHESLNATPQVAMQVLEI
HYTPSVKI--IPSTPFP-QEGQALTLTCESKGKPLPEPVLWTK 286

  Fly   503 DDGDTPVPQ---TGDGFLNFTSIRREHSGWYKCTSRHLNFQYSSIGYYLSVR------------- 551
            |..:.|.|.   .....||...:.:..:|.|:|.:.:...| ||..|.|.|.             
Mouse   287 DGAELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQ-SSAEYVLIVHDVPNTLLPTTIIP 350

  Fly   552 -------FDSVDVTSEPDDQDVSVAAAS---HNPN-----KGQLEVQLGGAVTL 590
                   ..||.:|:.|     |.:|:|   .:||     .|.....:||.|.:
Mouse   351 SLTTAPVTTSVTITTSP-----STSASSSSRRDPNSLAGQNGPDHALIGGIVAV 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 23/86 (27%)
Ig strand B 254..258 CDD:409353 1/1 (100%)
Ig strand C 267..271 CDD:409353 1/3 (33%)
Ig strand E 296..300 CDD:409353 0/6 (0%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 1/2 (50%)
Ig 359..452 CDD:472250 16/93 (17%)
Ig_3 478..533 CDD:464046 15/58 (26%)
IG_like 578..660 CDD:214653 4/13 (31%)
Cadm2XP_011244430.1 MtrA <9..>56 CDD:453061
IgV_1_Necl-3 49..144 CDD:409498 23/87 (26%)
Ig strand A 49..52 CDD:409498
FR1 50..68 CDD:409498 1/2 (50%)
Ig strand A' 53..59 CDD:409498
Ig strand B 61..69 CDD:409498 2/3 (67%)
CDR1 69..74 CDD:409498 2/4 (50%)
FR2 75..82 CDD:409498 2/6 (33%)
Ig strand C 75..81 CDD:409498 2/5 (40%)
CDR2 83..94 CDD:409498 2/10 (20%)
Ig strand C' 85..89 CDD:409498 1/3 (33%)
Ig strand C' 91..94 CDD:409498 1/2 (50%)
FR3 95..130 CDD:409498 8/39 (21%)
Ig strand D 99..106 CDD:409498 1/6 (17%)
Ig strand E 109..115 CDD:409498 0/5 (0%)
Ig strand F 122..130 CDD:409498 2/12 (17%)
CDR3 131..134 CDD:409498 1/5 (20%)
Ig strand G 134..144 CDD:409498 3/9 (33%)
FR4 136..143 CDD:409498 1/6 (17%)
IgI_2_Necl-3 143..246 CDD:409467 26/128 (20%)
Ig strand A 144..147 CDD:409467 1/2 (50%)
Ig strand A' 150..154 CDD:409467 1/12 (8%)
Ig strand B 163..173 CDD:409467 2/9 (22%)
Ig strand C 176..185 CDD:409467 2/20 (10%)
Ig strand C' 186..189 CDD:409467 0/2 (0%)
Ig strand D 191..198 CDD:409467 1/6 (17%)
Ig strand E 204..214 CDD:409467 1/9 (11%)
Ig strand F 222..230 CDD:409467 1/7 (14%)
Ig strand G 238..245 CDD:409467 2/6 (33%)
Ig_3 250..323 CDD:464046 21/75 (28%)
4.1m 411..429 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.