DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and IGSF9B

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_001264214.1 Gene:IGSF9B / 22997 HGNCID:32326 Length:1437 Species:Homo sapiens


Alignment Length:603 Identity:129/603 - (21%)
Similarity:198/603 - (32%) Gaps:188/603 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 VQATSSSSSATRSSVINETKAKRPRSTLHLAPEDMQPKP----------KEPVII--------ID 191
            |.|.:..|...|..||:              |...||.|          ..|:.|        :|
Human    33 VTARAGESVVLRCDVIH--------------PVTGQPPPYVVEWFKFGVPIPIFIKFGYYPPHVD 83

  Fly   192 DVEEFDSGTSTSDLIARKSREEAEEEEDEGPLEPRVLPL-----------------------RPV 233
              .|:....|..|  ....|.|....||:|..|.:||.|                       ...
Human    84 --PEYAGRASLHD--KASLRLEQVRSEDQGWYECKVLMLDQQYDTFHNGSWVHLTINAPPTFTET 144

  Fly   234 PPNPYEAEEMSVVYAEQHSEIKLMCEV---DLDIATSMWYKNGQVVHAMDRTARVTDYRFIKEAN 295
            ||...||:|        ...|.:.|..   ...|.|  |.|.|.::.|..: .:|:|        
Human   145 PPQYIEAKE--------GGSITMTCTAFGNPKPIVT--WLKEGTLLGASGK-YQVSD-------- 190

  Fly   296 GALTITNVMLEDDGKWQCEAENTRRYTENARPVKLVVLDRPKPPYLLIDSRRLDASNLFVPVKEN 360
            |:||:|:|..||.|.:.|     |.|:.....|....|....||:::     ....|:.|.:.::
Human   191 GSLTVTSVSREDRGAYTC-----RAYSIQGEAVHTTHLLVQGPPFIV-----SPPENITVNISQD 245

  Fly   361 SELNLACVSEGGNPRPTLTWEVLLSPGVDRHAQ-----KVSAEVLELEEIKGEKLDKDGYKINSG 420
            :.|.....:..||...|..|:       |.:..     |:...:|           .||..|...
Human   246 ALLTCRAEAYPGNLTYTWYWQ-------DENVYFQNDLKLRVRIL-----------IDGTLIIFR 292

  Fly   421 AKSEARLPAVYRAHHNARILCVMEHPTLKIRQNASLLLDVQYTPSFAISRTPGFGYPLREGIEVS 485
            .|.|          .:.:..||..: :|....:||..|.||| |:..::..|....|:  ||...
Human   293 VKPE----------DSGKYTCVPSN-SLGRSPSASAYLTVQY-PARVLNMPPVIYVPV--GIHGY 343

  Fly   486 LKCDVDSNPPST-PRWQKDDGDTPVPQT------GDGFLNFTSIRREHSGWYKCTSRHLNFQYSS 543
            ::|.||:.||:| .:|.||.....|.:.      .||.:.......|..|.|.|.      .|::
Human   344 IRCPVDAEPPATVVKWNKDGRPLQVEKNLGWTLMEDGSIRIEEATEEALGTYTCV------PYNT 402

  Fly   544 IGYYLSVRFDSVDVTSEPDDQDVSVAAASHNP------NKGQLEVQLGGAVTLQCPQGSLGCWSH 602
            :|..               .|.........:|      ...:...:.|..:.:.|....      
Human   403 LGTM---------------GQSAPARLVLKDPPYFTVLPGWEYRQEAGRELLIPCAAAG------ 446

  Fly   603 LDP---ISARLRG---LGYGSSQPTGQFSLKDVMYQDAGMYKCVGQSPTNKKKLEVLQSVTVSVK 661
             ||   |:.|..|   ....|:.|:|....:.:..:|.|.::||.   ||     |:.|:|.|..
Human   447 -DPFPVITWRKVGKPSRSKHSALPSGSLQFRALSKEDHGEWECVA---TN-----VVTSITASTH 502

  Fly   662 GAPTVMALNATPVAYPGS 679
                :..:..:|.| |||
Human   503 ----LTVIGTSPHA-PGS 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 22/90 (24%)
Ig strand B 254..258 CDD:409353 1/3 (33%)
Ig strand C 267..271 CDD:409353 1/3 (33%)
Ig strand E 296..300 CDD:409353 2/3 (67%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 0/2 (0%)
Ig 359..452 CDD:472250 16/97 (16%)
Ig_3 478..533 CDD:464046 17/61 (28%)
IG_like 578..660 CDD:214653 19/87 (22%)
IGSF9BNP_001264214.1 IG_like 30..115 CDD:214653 22/99 (22%)
Ig strand B 41..45 CDD:409353 0/3 (0%)
Ig strand C 59..63 CDD:409353 0/3 (0%)
Ig strand E 96..100 CDD:409353 0/3 (0%)
Ig strand F 110..115 CDD:409353 1/4 (25%)
I-set 139..225 CDD:400151 28/109 (26%)
Ig strand B 157..161 CDD:409353 1/3 (33%)
Ig strand C 170..174 CDD:409353 2/5 (40%)
Ig strand E 191..195 CDD:409353 2/3 (67%)
Ig strand F 205..210 CDD:409353 1/9 (11%)
Ig strand G 218..221 CDD:409353 1/2 (50%)
Ig_3 228..307 CDD:464046 19/111 (17%)
Ig 336..410 CDD:472250 22/96 (23%)
Ig strand B 342..346 CDD:409353 0/3 (0%)
Ig strand C 355..360 CDD:409353 1/4 (25%)
Ig strand E 380..384 CDD:409353 1/3 (33%)
Ig strand F 394..399 CDD:409353 2/10 (20%)
Ig strand G 407..410 CDD:409353 1/2 (50%)
Ig 429..505 CDD:472250 20/94 (21%)
Ig strand B 438..442 CDD:409353 0/3 (0%)
Ig strand C 451..455 CDD:409353 1/3 (33%)
Ig strand E 471..475 CDD:409353 1/3 (33%)
Ig strand F 485..490 CDD:409353 1/4 (25%)
FN3 <490..>731 CDD:442628 11/39 (28%)
Ig strand G 498..501 CDD:409353 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..817
PHA03247 <894..1242 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1081
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.