DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and Ncam2

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_001106679.1 Gene:Ncam2 / 17968 MGIID:97282 Length:837 Species:Mus musculus


Alignment Length:556 Identity:111/556 - (19%)
Similarity:199/556 - (35%) Gaps:167/556 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 EGPLEPR-------VLPLRPVPPNPYEAEEMSVVYAEQHSEIKLMCEVD-LDIATSMWYKNGQVV 276
            ||.:|.|       ::.:..|||.....::.....||:..|:.|.|:.. ....|..|::||:::
Mouse   187 EGRVEARGEIDFRDIIVIVNVPPAIMMPQKSFNATAERGEEMTLTCKASGSPDPTISWFRNGKLI 251

  Fly   277 HAMDRTARVTDYRFIKEANGALTITNVMLEDDGKWQCEAENTRRYTENARPVKLVVLDRPKPPYL 341
            ...::       ..:|.:|..||:.|::.:|.|.:.|:|  |.:..|:.:...|.|..:|....|
Mouse   252 EENEK-------YILKGSNTELTVRNIINKDGGSYVCKA--TNKAGEDQKQAFLQVFVQPHILQL 307

  Fly   342 LIDSRRLDASNLFVPVKENSELNLACVSEGGNPRPTLTWE-----VLLSPGVDRHAQKVSAEVLE 401
            ..::           ..||..:.|.|.:| |.|.|.:||:     |:.|.|......::      
Mouse   308 KNET-----------TSENGHVTLVCEAE-GEPVPEITWKRAIDGVMFSEGDKSPDGRI------ 354

  Fly   402 LEEIKGE----KLDKDGYKINSGAKSEARLPAVYRAHHNARILCVMEHPTLKIRQNASLLLDVQY 462
              |:||:    .|.....|::...:.:....:....|..                  |:.||::|
Mouse   355 --EVKGQHGRSSLHIRDVKLSDSGRYDCEAASRIGGHQR------------------SMHLDIEY 399

  Fly   463 TPSFAISRTPGFGYPLREGIEVSLKCDVDSNPPSTPRWQKDDGDTPVPQTGDGFLNFTSIRRE-- 525
            .|.|..::|..:.:   ||..:::.|||.:|||::..|:::....|...|  ..|...|:.|:  
Mouse   400 APKFVSNQTMYYSW---EGNPINISCDVTANPPASIHWRREKLLLPAKNT--THLKTHSVGRKMI 459

  Fly   526 ---------HSGWYKCTSRH---LNFQYSSIGYYLSVRFDSVDVTSEPDDQDVSVAAASHNPNKG 578
                     ..|.|.||:.:   ..||    .|.|.:    .||.|.|  ..|.:...|....| 
Mouse   460 LEIAPTSDNDFGRYNCTATNRIGTRFQ----EYILEL----ADVPSSP--HGVKIIELSQTTAK- 513

  Fly   579 QLEVQLGGAVTLQCPQGSLGCWSHLDPISAR---------LRGLG------YGSSQPTGQFSLKD 628
                     ::...|:...|...|...:..:         :|..|      ..|.:|...:.::.
Mouse   514 ---------ISFNKPESHGGVPIHHYQVDVKEVASETWKIVRSHGVQTMVVLSSLEPNTTYEIRV 569

  Fly   629 VMYQDAGMYKCVGQSPTNKKKLEVLQSVTVSVKGAPTVMALNATPVAYPGSPLHLNVEFCANPPA 693
            ....        |:...:..|:|:.|::                ||..|            :||:
Mouse   570 AAVN--------GKGQGDYSKIEIFQTL----------------PVREP------------SPPS 598

  Fly   694 HAARWLHGD----RVF----TPGNQYGTTVLAYAVK 721
                 :||.    :.|    |..:..|..:|.|.||
Mouse   599 -----IHGQPSSGKSFKISITKQDDGGAPILEYIVK 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 21/88 (24%)
Ig strand B 254..258 CDD:409353 1/3 (33%)
Ig strand C 267..271 CDD:409353 1/3 (33%)
Ig strand E 296..300 CDD:409353 1/3 (33%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 0/2 (0%)
Ig 359..452 CDD:472250 19/101 (19%)
Ig_3 478..533 CDD:464046 16/65 (25%)
IG_like 578..660 CDD:214653 11/96 (11%)
Ncam2NP_001106679.1 IgI_1_NCAM-2 21..113 CDD:409452
Ig strand A 21..26 CDD:409452
Ig strand A' 29..33 CDD:409452
Ig strand B 35..45 CDD:409452
Ig strand C 49..55 CDD:409452
Ig strand C' 58..60 CDD:409452
Ig strand D 66..72 CDD:409452
Ig strand E 74..82 CDD:409452
Ig strand F 89..96 CDD:409452
Ig strand G 101..112 CDD:409452
IG_like 122..187 CDD:214653 111/556 (20%)
Ig strand B 132..136 CDD:409353
Ig strand C 145..152 CDD:409353
Ig strand E 169..173 CDD:409353
Ig strand F 183..187 CDD:409353 111/556 (20%)
Ig strand G 191..194 CDD:409353 1/2 (50%)
IgI_1_MuSK 209..298 CDD:409562 22/97 (23%)
Ig strand A 209..212 CDD:409562 1/2 (50%)
Ig strand A' 217..222 CDD:409562 0/4 (0%)
Ig strand B 228..235 CDD:409562 2/6 (33%)
Ig strand C 241..246 CDD:409562 2/4 (50%)
Ig strand C' 248..250 CDD:409562 1/1 (100%)
Ig strand D 257..260 CDD:409562 0/2 (0%)
Ig strand E 264..270 CDD:409562 2/5 (40%)
Ig strand F 277..284 CDD:409562 3/8 (38%)
Ig strand G 290..298 CDD:409562 1/7 (14%)
Ig 300..397 CDD:472250 23/134 (17%)
Ig strand B 318..322 CDD:409353 1/3 (33%)
Ig strand C 331..335 CDD:409353 1/3 (33%)
Ig strand E 363..367 CDD:409353 1/3 (33%)
Ig strand F 377..382 CDD:409353 0/4 (0%)
Ig strand G 390..393 CDD:409353 0/20 (0%)
Ig_3 401..479 CDD:464046 21/82 (26%)
FN3 496..588 CDD:238020 15/111 (14%)
fn3 594..678 CDD:394996 12/53 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 764..810
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.