DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and CNTN1

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_001834.2 Gene:CNTN1 / 1272 HGNCID:2171 Length:1018 Species:Homo sapiens


Alignment Length:625 Identity:135/625 - (21%)
Similarity:220/625 - (35%) Gaps:176/625 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 ETKAKRPRSTLHLA------PEDMQPK---PKEPVIIIDDVEEFDSGTSTSDLIARKSREEAEEE 217
            |.:.|..:..:.|.      |:|:..:   .:.||.|..|...|.|.|:.:..||.      .|.
Human   145 EVRVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVFITMDKRRFVSQTNGNLYIAN------VEA 203

  Fly   218 EDEG-------------PLEPRVLPLRPVP---PNPYEAE---EMSVVYAEQHSEIKLMC-EVDL 262
            .|:|             .:..:.:||.|:|   ..||.|:   :...|||.....:.|.| .:..
Human   204 SDKGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPYPADIVVQFKDVYALMGQNVTLECFALGN 268

  Fly   263 DIATSMWYKNGQVVHAMDRTARVTDYRFIKEANGA-LTITNVMLEDDGKWQCEAENTRRYTENAR 326
            .:....|.|   |:..|..||.::       .:|| |.|.|:.|||:|.::|||||.|  .::..
Human   269 PVPDIRWRK---VLEPMPSTAEIS-------TSGAVLKIFNIQLEDEGIYECEAENIR--GKDKH 321

  Fly   327 PVKLVVLDRPKPPYLLIDSRRLDASNLFVPVKENSELNLACVSEGGNPRPTLTWEVLLSPGVDRH 391
            ..::.|...|:....:.|:.....|:|:.|          ||:. |.|.||:.|.          
Human   322 QARIYVQAFPEWVEHINDTEVDIGSDLYWP----------CVAT-GKPIPTIRWL---------- 365

  Fly   392 AQKVSAEVLELEEIKGEKLDKDGYKINSGAKSEARLPAVYRAHHNARIL-CVMEHPTLKIRQNAS 455
                                |:||..:.|   |.||..|  ...||.:. |:.|:....|..||.
Human   366 --------------------KNGYAYHKG---ELRLYDV--TFENAGMYQCIAENTYGAIYANAE 405

  Fly   456 LLLDVQYTPSFAISRTPGFGYPLR------EGIEVSLKCDVDSNPPSTPRWQKDD----GDTPVP 510
            |.: :...|:|.::       |::      :|..|.::|...:.|.....|.|..    ..:.:.
Human   406 LKI-LALAPTFEMN-------PMKKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSRIL 462

  Fly   511 QTGDGFLNFTSIRREHSGWYKCTSRHLNFQYSSIGYYLSVRFDSVDVTSEPDDQDVSVAAASHNP 575
            ...||.|...:|.|...|.|.|.:.:...:.:|.|  ..|..|...:...|.:.|::|       
Human   463 IWEDGSLEINNITRNDGGIYTCFAENNRGKANSTG--TLVITDPTRIILAPINADITV------- 518

  Fly   576 NKGQLEVQLGGAVTLQCPQGSLGCWSHLDP--------------ISARLRGLGYGSS---QPTGQ 623
                     |...|:||.       :..||              |......:.|..:   ...|:
Human   519 ---------GENATMQCA-------ASFDPALDLTFVWSFNGYVIDFNKENIHYQRNFMLDSNGE 567

  Fly   624 FSLKDVMYQDAGMYKCVGQSPTNKKKLEVLQSVTVSVKGAPTVMALNATPVAYPGSPLHLNVEFC 688
            ..:::...:.||.|.|..|:..:...    .|..:.|:|.             ||.|..|.:| .
Human   568 LLIRNAQLKHAGRYTCTAQTIVDNSS----ASADLVVRGP-------------PGPPGGLRIE-D 614

  Fly   689 ANPPAHAARWLHGDRVFTPGNQY---GTTVLAYAVKDLPT 725
            ....:.|..|..|....:|.::|   ..|:|:...||..|
Human   615 IRATSVALTWSRGSDNHSPISKYTIQTKTILSDDWKDAKT 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 26/89 (29%)
Ig strand B 254..258 CDD:409353 1/3 (33%)
Ig strand C 267..271 CDD:409353 1/3 (33%)
Ig strand E 296..300 CDD:409353 3/4 (75%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 0/2 (0%)
Ig 359..452 CDD:472250 20/93 (22%)
Ig_3 478..533 CDD:464046 13/64 (20%)
IG_like 578..660 CDD:214653 15/98 (15%)
CNTN1NP_001834.2 IgI_1_Contactin-1 40..134 CDD:409436
Ig strand A 42..46 CDD:409436
Ig strand A' 49..54 CDD:409436
Ig strand B 60..68 CDD:409436
Ig strand C 73..79 CDD:409436
Ig strand C' 81..84 CDD:409436
Ig strand D 90..94 CDD:409436
Ig strand E 96..102 CDD:409436
Ig strand F 109..118 CDD:409436
Ig strand G 121..134 CDD:409436
Ig2_Contactin-2-like 142..230 CDD:409392 18/90 (20%)
Ig strand A 144..149 CDD:409392 1/3 (33%)
Ig strand B 153..159 CDD:409392 1/5 (20%)
Ig strand C 168..174 CDD:409392 0/5 (0%)
Ig strand C' 179..181 CDD:409392 1/1 (100%)
Ig strand D 186..191 CDD:409392 1/4 (25%)
Ig strand E 194..198 CDD:409392 0/3 (0%)
Ig strand F 208..216 CDD:409392 0/7 (0%)
Ig strand G 218..230 CDD:409392 1/11 (9%)
IgI_3_Contactin-1 241..328 CDD:143259 27/98 (28%)
Ig strand A 241..246 CDD:143259 1/4 (25%)
Ig strand A' 249..254 CDD:143259 2/4 (50%)
Ig strand B 257..266 CDD:143259 2/8 (25%)
Ig strand C 272..276 CDD:143259 0/3 (0%)
Ig strand C' 279..281 CDD:143259 0/1 (0%)
Ig strand D 289..292 CDD:143259 0/9 (0%)
Ig strand E 293..298 CDD:143259 2/4 (50%)
Ig strand F 306..314 CDD:143259 4/7 (57%)
Ig strand G 317..328 CDD:143259 0/10 (0%)
Ig 332..408 CDD:472250 27/121 (22%)
Ig strand B 348..352 CDD:143205 2/13 (15%)
Ig strand C 361..365 CDD:143205 1/3 (33%)
Ig strand E 374..378 CDD:143205 2/6 (33%)
Ig strand F 388..393 CDD:143205 1/4 (25%)
Ig strand G 401..404 CDD:143205 0/2 (0%)
Ig5_Contactin-1 413..501 CDD:409438 19/96 (20%)
Ig strand A 413..418 CDD:409438 2/4 (50%)
Ig strand A' 421..426 CDD:409438 0/4 (0%)
Ig strand B 430..437 CDD:409438 1/6 (17%)
Ig strand C 445..449 CDD:409438 0/3 (0%)
Ig strand D 463..466 CDD:409438 0/2 (0%)
Ig strand E 467..472 CDD:409438 2/4 (50%)
Ig strand F 480..488 CDD:409438 3/7 (43%)
Ig strand G 494..501 CDD:409438 2/8 (25%)
Ig6_Contactin 503..601 CDD:409359 19/124 (15%)
Ig strand A 503..509 CDD:409359 1/5 (20%)
Ig strand A' 512..517 CDD:409359 1/4 (25%)
Ig strand B 520..528 CDD:409359 3/14 (21%)
Ig strand C 537..541 CDD:409359 0/3 (0%)
Ig strand D 562..565 CDD:409359 0/2 (0%)
Ig strand E 566..570 CDD:409359 1/3 (33%)
Ig strand F 579..586 CDD:409359 3/6 (50%)
Ig strand G 593..597 CDD:409359 1/7 (14%)
FN3 610..697 CDD:238020 12/46 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 693..717
FN3 <745..>945 CDD:442628
fn3 811..893 CDD:394996
FN3 905..989 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.