| Sequence 1: | NP_523731.2 | Gene: | tei / 36521 | FlyBaseID: | FBgn0000633 | Length: | 822 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002940155.1 | Gene: | nectin3 / 100496233 | XenbaseID: | XB-GENE-963226 | Length: | 524 | Species: | Xenopus tropicalis |
| Alignment Length: | 117 | Identity: | 27/117 - (23%) |
|---|---|---|---|
| Similarity: | 48/117 - (41%) | Gaps: | 17/117 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 285 NTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDM-VSPTEI-GLRRVLVGHRAAVNVVDFDEKYI 347
Fly 348 VSASGDRTIKVWNSTNCEFLRTLNGHKRGIACLQYRDRLVVSGSSDNSIRLW 399 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| tei | NP_523731.2 | IG_like | 244..332 | CDD:214653 | 14/48 (29%) |
| Ig strand B | 254..258 | CDD:409353 | |||
| Ig strand C | 267..271 | CDD:409353 | |||
| Ig strand E | 296..300 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 310..315 | CDD:409353 | 1/4 (25%) | ||
| Ig strand G | 326..329 | CDD:409353 | 0/2 (0%) | ||
| Ig | 359..452 | CDD:472250 | 7/41 (17%) | ||
| Ig_3 | 478..533 | CDD:464046 | |||
| IG_like | 578..660 | CDD:214653 | |||
| nectin3 | XP_002940155.1 | Ig | 29..138 | CDD:472250 | 20/81 (25%) |
| Ig strand B | 45..49 | CDD:409353 | |||
| Ig strand C | 59..63 | CDD:409353 | 27/117 (23%) | ||
| Ig strand E | 102..106 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 116..121 | CDD:409353 | 1/4 (25%) | ||
| Ig strand G | 130..133 | CDD:409353 | 1/2 (50%) | ||
| IgC1_2_Nectin-3-4_like | 141..236 | CDD:409501 | 7/32 (22%) | ||
| Ig strand A | 141..147 | CDD:409501 | 1/5 (20%) | ||
| Ig strand B | 160..167 | CDD:409501 | 2/5 (40%) | ||
| Ig strand C | 172..178 | CDD:409501 | |||
| Ig strand C' | 180..182 | CDD:409501 | |||
| Ig strand D | 184..191 | CDD:409501 | |||
| Ig strand E | 196..204 | CDD:409501 | |||
| Ig strand F | 214..221 | CDD:409501 | |||
| Ig strand G | 227..233 | CDD:409501 | |||
| Ig | 240..326 | CDD:472250 | |||
| Ig strand B | 258..262 | CDD:409353 | |||
| Ig strand C | 272..276 | CDD:409353 | |||
| Ig strand E | 292..296 | CDD:409353 | |||
| Ig strand F | 306..311 | CDD:409353 | |||
| Ig strand G | 321..324 | CDD:409353 | |||
| ECM27 | 347..>408 | CDD:440296 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||