DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and nectin3

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:XP_002940155.1 Gene:nectin3 / 100496233 XenbaseID:XB-GENE-963226 Length:524 Species:Xenopus tropicalis


Alignment Length:117 Identity:27/117 - (23%)
Similarity:48/117 - (41%) Gaps:17/117 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 NTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDM-VSPTEI-GLRRVLVGHRAAVNVVDFDEKYI 347
            |.|:...||.|......|:.:..|.|...   || :||.|. .:...|.|   .....|::|:.:
 Frog    63 NELVRQQEAALRTLGAEGLFLFSSLDTDN---DMHISPEEFKPISEKLTG---ISTTSDYEEEEL 121

  Fly   348 VSASGDRTIKVWNSTNCEFLRTLNGHKRGIACLQYRDRLVVSGSSDNSIRLW 399
            :..:|: |:.|.:......:.|:...|.|.        |.::.|:.:.:|.|
 Frog   122 LDPNGE-TLSVASRFQPLLMETMTKSKDGF--------LGITHSALSGLRNW 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 14/48 (29%)
Ig strand B 254..258 CDD:409353
Ig strand C 267..271 CDD:409353
Ig strand E 296..300 CDD:409353 0/3 (0%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 0/2 (0%)
Ig 359..452 CDD:472250 7/41 (17%)
Ig_3 478..533 CDD:464046
IG_like 578..660 CDD:214653
nectin3XP_002940155.1 Ig 29..138 CDD:472250 20/81 (25%)
Ig strand B 45..49 CDD:409353
Ig strand C 59..63 CDD:409353 27/117 (23%)
Ig strand E 102..106 CDD:409353 0/3 (0%)
Ig strand F 116..121 CDD:409353 1/4 (25%)
Ig strand G 130..133 CDD:409353 1/2 (50%)
IgC1_2_Nectin-3-4_like 141..236 CDD:409501 7/32 (22%)
Ig strand A 141..147 CDD:409501 1/5 (20%)
Ig strand B 160..167 CDD:409501 2/5 (40%)
Ig strand C 172..178 CDD:409501
Ig strand C' 180..182 CDD:409501
Ig strand D 184..191 CDD:409501
Ig strand E 196..204 CDD:409501
Ig strand F 214..221 CDD:409501
Ig strand G 227..233 CDD:409501
Ig 240..326 CDD:472250
Ig strand B 258..262 CDD:409353
Ig strand C 272..276 CDD:409353
Ig strand E 292..296 CDD:409353
Ig strand F 306..311 CDD:409353
Ig strand G 321..324 CDD:409353
ECM27 347..>408 CDD:440296
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.