DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment PDX1 and Ubx

DIOPT Version :9

Sequence 1:	NP_000200.1	Gene:	PDX1 / 3651	HGNCID:	6107	Length:	283	Species:	Homo sapiens
Sequence 2:	NP_536752.1	Gene:	Ubx / 42034	FlyBaseID:	FBgn0003944	Length:	389	Species:	Drosophila melanogaster

Alignment Length:	90	Identity:	45/90 - (50%)
Similarity:	52/90 - (57%)	Gaps:	18/90 - (20%)

- Green bases have known domain annotations that are detailed below.

Human   147 KRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKE------- 204
            :|.|..|||.|.|||||||..|.|::|.||:|:|..|.||||.|||||||||||.|||
  Fly   296 RRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKEL 360

Human   205 -EDKKR----------GGGTAVGGG 218
             |.:|:          ....||.||
  Fly   361 NEQEKQAQAQKAAAAAAAAAAVQGG 385

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
PDX1	NP_000200.1	Transactivation domain. /evidence=ECO:0000250	13..73
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	34..71
		Antp-type hexapeptide	118..123
		Homeobox	149..202	CDD:278475	35/52 (67%)
		Nuclear localization signal. /evidence=ECO:0000250	197..203		4/5 (80%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	201..283		9/36 (25%)
Ubx	NP_536752.1	Homeobox	299..352	CDD:395001	35/52 (67%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0489
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810