DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDX1 and Antp

DIOPT Version :9

Sequence 1:NP_000200.1 Gene:PDX1 / 3651 HGNCID:6107 Length:283 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:302 Identity:90/302 - (29%)
Similarity:114/302 - (37%) Gaps:122/302 - (40%)


- Green bases have known domain annotations that are detailed below.


Human     4 EEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPY 68
            ::|....||....|...|:.|....|....|.:               |.||.:.:|..      
  Fly   136 QQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAV---------------GGLGMVPEGGS------ 179

Human    69 EVPPLADDPAVAHLHHHLPAQLALPH--------------------------------------P 95
              |||.|..:    .||:.||:.|||                                      |
  Fly   180 --PPLVDQMS----GHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVP 238

Human    96 PAGPFPEG-------------AEPGVLEEPNRVQLP-----------FPWMKSTKAHAWKGQWAG 136
            |.|..|:|             ..||....|:  |.|           :|||:|            
  Fly   239 PVGAPPQGMMHQGQGPPQMHQGHPGQHTPPS--QNPNSQSSGMPSPLYPWMRS------------ 289

Human   137 GAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKW 201
              ...:.:|.||.|..|||.|.|||||||.||:|::|.||:|:|..|.||||.||||||||||||
  Fly   290 --QFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW 352

Human   202 KKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPPPPP 243
            || |:|.:|   ..|.||           .|:|:  .||..|
  Fly   353 KK-ENKTKG---EPGSGG-----------EGDEI--TPPNSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDX1NP_000200.1 Transactivation domain. /evidence=ECO:0000250 13..73 10/59 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..71 5/36 (14%)
Antp-type hexapeptide 118..123 3/15 (20%)
Homeobox 149..202 CDD:278475 36/52 (69%)
Nuclear localization signal. /evidence=ECO:0000250 197..203 5/5 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..283 14/43 (33%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 36/187 (19%)
Homeobox 301..354 CDD:395001 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.