DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDX1 and ftz

DIOPT Version :9

Sequence 1:NP_000200.1 Gene:PDX1 / 3651 HGNCID:6107 Length:283 Species:Homo sapiens
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:269 Identity:81/269 - (30%)
Similarity:110/269 - (40%) Gaps:74/269 - (27%)


- Green bases have known domain annotations that are detailed below.


Human     7 YYAATQLYKDPCAFQR---GPAPEFS------ASPPACL---YMGRQPPPPPPHPFPGALGALEQ 59
            |....|:.|.|....:   .|||.:.      .:|.|..   |:....|.....       .|:.
  Fly   128 YTTVEQVKKAPAVSTKVTASPAPSYDQEYVTVPTPSASEDVDYLDVYSPQSQTQ-------KLKN 185

Human    60 G---SPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNR--VQLP- 118
            |   :||..:|..:|||.                .:..||..| .|.:...|.:|.|.  |..| 
  Fly   186 GDFATPPPTTPTSLPPLE----------------GISTPPQSP-GEKSSSAVSQEINHRIVTAPN 233

Human   119 ----FPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVEL 179
                |.|     :|..:      ..|::.:::||||..|||.|.|||||||.||:||:|.||:::
  Fly   234 GAGDFNW-----SHIEE------TLASDCKDSKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDI 287

Human   180 AVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPPPPPP 244
            |..|:|:||.|||||||||||.||:....            :.||. |    |....|:.||...
  Fly   288 ANALSLSERQIKIWFQNRRMKSKKDRTLD------------SSPEH-C----GAGYTAMLPPLEA 335

Human   245 GGAVPPAAP 253
            .......||
  Fly   336 TSTATTGAP 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDX1NP_000200.1 Transactivation domain. /evidence=ECO:0000250 13..73 15/74 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..71 8/42 (19%)
Antp-type hexapeptide 118..123 3/9 (33%)
Homeobox 149..202 CDD:278475 36/52 (69%)
Nuclear localization signal. /evidence=ECO:0000250 197..203 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..283 11/53 (21%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 31/154 (20%)
Homeobox 257..310 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.