Sequence 1: | NP_000200.1 | Gene: | PDX1 / 3651 | HGNCID: | 6107 | Length: | 283 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_477146.1 | Gene: | unpg / 35942 | FlyBaseID: | FBgn0015561 | Length: | 485 | Species: | Drosophila melanogaster |
Alignment Length: | 330 | Identity: | 90/330 - (27%) |
---|---|---|---|
Similarity: | 119/330 - (36%) | Gaps: | 114/330 - (34%) |
- Green bases have known domain annotations that are detailed below.
Human 7 YYA-----ATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDI- 65
Human 66 SPYEVPPLADDPAVAHLH------------------HHLPAQLALPH-PPAGPFPEG-AEPGV-- 108
Human 109 LEEPNRVQLPFPWMKSTKAHA--------------------------------WKGQW---AGGA 138
Human 139 YAAEPEE--------------------------------NKRTRTAYTRAQLLELEKEFLFNKYI 171
Human 172 SRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELL 236
Human 237 ALPPP 241 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PDX1 | NP_000200.1 | Transactivation domain. /evidence=ECO:0000250 | 13..73 | 20/60 (33%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 34..71 | 14/37 (38%) | |||
Antp-type hexapeptide | 118..123 | 0/4 (0%) | |||
Homeobox | 149..202 | CDD:278475 | 29/52 (56%) | ||
Nuclear localization signal. /evidence=ECO:0000250 | 197..203 | 4/5 (80%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 201..283 | 11/41 (27%) | |||
unpg | NP_477146.1 | Homeobox | 324..375 | CDD:278475 | 28/50 (56%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |