DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDX1 and unpg

DIOPT Version :9

Sequence 1:NP_000200.1 Gene:PDX1 / 3651 HGNCID:6107 Length:283 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:330 Identity:90/330 - (27%)
Similarity:119/330 - (36%) Gaps:114/330 - (34%)


- Green bases have known domain annotations that are detailed below.


Human     7 YYA-----ATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDI- 65
            |:|     .|.|....|.....||...:|..|..   ..||.||||||   ...|||:..||.: 
  Fly    92 YFAQNHERLTHLIAGGCYLPSSPAGHPAAQQPQA---QAQPQPPPPHP---PTHALEKQLPPTLP 150

Human    66 SPYEVPPLADDPAVAHLH------------------HHLPAQLALPH-PPAGPFPEG-AEPGV-- 108
            .|.:...|..:||.|.:.                  |.|.....|.| ..||...|. |.||:  
  Fly   151 HPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQ 215

Human   109 LEEPNRVQLPFPWMKSTKAHA--------------------------------WKGQW---AGGA 138
            |:||...|......|| .:|:                                :.|:.   ..||
  Fly   216 LQEPTPPQAHSSPAKS-GSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGA 279

Human   139 YAAEPEE--------------------------------NKRTRTAYTRAQLLELEKEFLFNKYI 171
            |.....|                                ::|.|||:|..||||||:||...||:
  Fly   280 YTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYL 344

Human   172 SRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELL 236
            |...|.::|..|.|:|..:||||||||.|||    :.:.|.|:.|.|       ....|||.:::
  Fly   345 SLTERSQIATSLKLSEVQVKIWFQNRRAKWK----RVKAGLTSHGLG-------RNGTTSGTKIV 398

Human   237 ALPPP 241
             :|.|
  Fly   399 -VPIP 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDX1NP_000200.1 Transactivation domain. /evidence=ECO:0000250 13..73 20/60 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..71 14/37 (38%)
Antp-type hexapeptide 118..123 0/4 (0%)
Homeobox 149..202 CDD:278475 29/52 (56%)
Nuclear localization signal. /evidence=ECO:0000250 197..203 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..283 11/41 (27%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/50 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.