DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roe1 and AR192

DIOPT Version :9

Sequence 1:NP_610886.2 Gene:Roe1 / 36508 FlyBaseID:FBgn0014877 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_567757.1 Gene:AR192 / 828785 AraportID:AT4G26780 Length:327 Species:Arabidopsis thaliana


Alignment Length:261 Identity:87/261 - (33%)
Similarity:125/261 - (47%) Gaps:49/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAKAALPLQMFG----------RRLVHLRSSVTSQ-------NMSALRLYSTEKQPEEATEQK- 47
            ||...:..||.|.          .:..|..:|.||:       |...|...|.:...:.|..:: 
plant    54 MSMMDSFALQRFNFSSSTSPESDEKKTHTEASKTSEEKPTAEANQPGLDSESKDSVTDSAKRKRK 118

  Fly    48 ----ATESSPEVE--------------KLTKE----LAAAKEQNAELMDKYKRSLADSENMRNRL 90
                |..||.|.:              ||..|    |:..:|:..:|.||..|:.|:.||:.:|.
plant   119 GAKGAASSSSESDSESDDDELSADDLVKLVAEKEELLSEKEEEIKQLKDKVLRTYAEMENVMDRT 183

  Fly    91 NKQISDAKIFGIQSFCKDLLEVADTLGHATQAVPK--DKLSGNAD-------LKNLYEGLTMTRA 146
            .:...:.|.:.:|:|.|.||:|||.||.|:..|.:  .||..:.|       ||.|.||:.||..
plant   184 RRDAENTKKYAVQNFAKSLLDVADNLGRASSVVKESFSKLDTSEDSAGAAPLLKTLLEGVEMTEK 248

  Fly   147 SLLQVFKRHGLEPLDPINQKFDPNQHEALFQKEDKTVEPNTVVEVTKLGYKLHERCIRPALVGVS 211
            .|.:|||:.|:|..||||:.||||:|.|:||..|.:....||..|.|.||.|::|.||||.|||:
plant   249 QLAEVFKKFGMEKYDPINEPFDPNRHNAVFQVPDASKPEGTVAHVLKSGYTLYDRVIRPAEVGVT 313

  Fly   212 K 212
            :
plant   314 Q 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roe1NP_610886.2 GrpE 70..210 CDD:271355 63/148 (43%)
2-helical coiled coil 70..120 CDD:271355 19/49 (39%)
2-helical coiled coil 140..155 CDD:271355 7/14 (50%)
AR192NP_567757.1 GrpE 163..312 CDD:271355 63/148 (43%)
2-helical coiled coil 163..227 CDD:271355 23/63 (37%)
2-helical coiled coil 242..257 CDD:271355 7/14 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 123 1.000 Domainoid score I1832
eggNOG 1 0.900 - - E1_COG0576
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1930
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1525208at2759
OrthoFinder 1 1.000 - - FOG0001525
OrthoInspector 1 1.000 - - otm2469
orthoMCL 1 0.900 - - OOG6_100642
Panther 1 1.100 - - LDO PTHR21237
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1249
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.