DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roe1 and GRPEL1

DIOPT Version :9

Sequence 1:NP_610886.2 Gene:Roe1 / 36508 FlyBaseID:FBgn0014877 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_079472.1 Gene:GRPEL1 / 80273 HGNCID:19696 Length:217 Species:Homo sapiens


Alignment Length:212 Identity:101/212 - (47%)
Similarity:133/212 - (62%) Gaps:7/212 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AKAALP-LQMFGRRLVHLRSSVTSQNMSALRLYSTEKQPEEATEQKATESSPEVEKLTKELAAAK 66
            |:.:|| |.:..|....|..:.|.|..|...|.....|.|:..:..|||.:     |.:|....:
Human     9 ARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKT-----LLEEKVKLE 68

  Fly    67 EQNAELMDKYKRSLADSENMRNRLNKQISDAKIFGIQSFCKDLLEVADTLGHATQAVPKDKL-SG 130
            ||..|.::||||:|||:||:|.|..|.:.:||::|||:||||||||||.|..|||.|||::: ..
Human    69 EQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDD 133

  Fly   131 NADLKNLYEGLTMTRASLLQVFKRHGLEPLDPINQKFDPNQHEALFQKEDKTVEPNTVVEVTKLG 195
            |..||||||||.||...:.:||.:|||..|:|:..||||.:|||||....:..||.||..|:|:|
Human   134 NPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVG 198

  Fly   196 YKLHERCIRPALVGVSK 212
            ||||.|.:|||||||.|
Human   199 YKLHGRTLRPALVGVVK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roe1NP_610886.2 GrpE 70..210 CDD:271355 79/140 (56%)
2-helical coiled coil 70..120 CDD:271355 29/49 (59%)
2-helical coiled coil 140..155 CDD:271355 6/14 (43%)
GRPEL1NP_079472.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..56 6/26 (23%)
GrpE 72..213 CDD:271355 79/140 (56%)
2-helical coiled coil 72..122 CDD:271355 29/49 (59%)
2-helical coiled coil 143..158 CDD:271355 6/14 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147769
Domainoid 1 1.000 174 1.000 Domainoid score I3691
eggNOG 1 0.900 - - E1_COG0576
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6992
Inparanoid 1 1.050 178 1.000 Inparanoid score I4037
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61230
OrthoDB 1 1.010 - - D1525208at2759
OrthoFinder 1 1.000 - - FOG0001525
OrthoInspector 1 1.000 - - otm42146
orthoMCL 1 0.900 - - OOG6_100642
Panther 1 1.100 - - LDO PTHR21237
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R526
SonicParanoid 1 1.000 - - X1249
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.