DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roe1 and Grpel1

DIOPT Version :9

Sequence 1:NP_610886.2 Gene:Roe1 / 36508 FlyBaseID:FBgn0014877 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_006251204.1 Gene:Grpel1 / 79563 RGDID:70947 Length:230 Species:Rattus norvegicus


Alignment Length:216 Identity:103/216 - (47%)
Similarity:131/216 - (60%) Gaps:30/216 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GRRLVHLRSSVTSQNMSALRLYSTEKQPEEATEQK---------------ATESSPEVEKLTKEL 62
            ||..|::|.|.        ||..|      ||:||               .|:.|...:.|.:|.
  Rat    27 GRPKVNIRPSP--------RLLCT------ATKQKNNGQNLEEDLGHCEPKTDPSSADKTLLEEK 77

  Fly    63 AAAKEQNAELMDKYKRSLADSENMRNRLNKQISDAKIFGIQSFCKDLLEVADTLGHATQAVPKDK 127
            ...:||..|.|:||||:|||:||:|.|..|.:.:||::|||.||||||||||.|..|||:|||::
  Rat    78 VKLEEQLKETMEKYKRALADTENLRQRSQKLVEEAKLYGIQGFCKDLLEVADILEKATQSVPKEE 142

  Fly   128 LS-GNADLKNLYEGLTMTRASLLQVFKRHGLEPLDPINQKFDPNQHEALFQKEDKTVEPNTVVEV 191
            :| .|..||:|||||.||...:.:||.:|||..||||..||||.:|||||....:..||.||..|
  Rat   143 VSNNNPHLKSLYEGLVMTEVQIQKVFTKHGLLRLDPIGAKFDPYEHEALFHTPVEGKEPGTVALV 207

  Fly   192 TKLGYKLHERCIRPALVGVSK 212
            :|:|||||.|.:|||||||.|
  Rat   208 SKVGYKLHGRTLRPALVGVVK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roe1NP_610886.2 GrpE 70..210 CDD:271355 82/140 (59%)
2-helical coiled coil 70..120 CDD:271355 30/49 (61%)
2-helical coiled coil 140..155 CDD:271355 6/14 (43%)
Grpel1XP_006251204.1 GrpE 85..226 CDD:271355 82/140 (59%)
2-helical coiled coil 85..135 CDD:271355 30/49 (61%)
2-helical coiled coil 156..171 CDD:271355 6/14 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341629
Domainoid 1 1.000 173 1.000 Domainoid score I3605
eggNOG 1 0.900 - - E1_COG0576
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6992
Inparanoid 1 1.050 175 1.000 Inparanoid score I3968
OMA 1 1.010 - - QHG61230
OrthoDB 1 1.010 - - D1525208at2759
OrthoFinder 1 1.000 - - FOG0001525
OrthoInspector 1 1.000 - - oto98561
orthoMCL 1 0.900 - - OOG6_100642
Panther 1 1.100 - - LDO PTHR21237
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1249
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.