DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roe1 and grpel1

DIOPT Version :9

Sequence 1:NP_610886.2 Gene:Roe1 / 36508 FlyBaseID:FBgn0014877 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001016179.1 Gene:grpel1 / 548933 XenbaseID:XB-GENE-973857 Length:216 Species:Xenopus tropicalis


Alignment Length:209 Identity:100/209 - (47%)
Similarity:134/209 - (64%) Gaps:11/209 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QMFGRRLVHLRSSVTS-QNMSALRLYSTEKQ----PEEATEQKATESSPEVEKLTKELAAAKEQN 69
            |.||   ..|||:.|. :....|...:|::|    .:|...:..||.||  ::...|.|..::|.
 Frog    11 QSFG---AVLRSAQTPVRTCPRLMCTATKEQNNPTQDEDKSKNQTEESP--DQAATEKAKLEDQI 70

  Fly    70 AELMDKYKRSLADSENMRNRLNKQISDAKIFGIQSFCKDLLEVADTLGHATQAVPKDKLSG-NAD 133
            .:|.|||||:|||:||:|.|..|.:.:||::|||.||||||||||.|..||::|||.::.. |..
 Frog    71 KDLTDKYKRALADTENLRQRSKKLVDEAKLYGIQGFCKDLLEVADILEKATESVPKAEIKAENPH 135

  Fly   134 LKNLYEGLTMTRASLLQVFKRHGLEPLDPINQKFDPNQHEALFQKEDKTVEPNTVVEVTKLGYKL 198
            ||||||||.||...:.:|.|:||:..|:|:..||:|.:|||||....:..||.||..|||:||||
 Frog   136 LKNLYEGLIMTEVQMQKVLKKHGVVKLNPVGDKFNPYEHEALFHSPVEGKEPGTVALVTKVGYKL 200

  Fly   199 HERCIRPALVGVSK 212
            |||.:|||||||.|
 Frog   201 HERTLRPALVGVVK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roe1NP_610886.2 GrpE 70..210 CDD:271355 79/140 (56%)
2-helical coiled coil 70..120 CDD:271355 30/49 (61%)
2-helical coiled coil 140..155 CDD:271355 6/14 (43%)
grpel1NP_001016179.1 GrpE 71..212 CDD:271355 79/140 (56%)
2-helical coiled coil 71..121 CDD:271355 30/49 (61%)
2-helical coiled coil 142..157 CDD:271355 6/14 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 173 1.000 Domainoid score I3668
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6992
Inparanoid 1 1.050 175 1.000 Inparanoid score I3951
OMA 1 1.010 - - QHG61230
OrthoDB 1 1.010 - - D1525208at2759
OrthoFinder 1 1.000 - - FOG0001525
OrthoInspector 1 1.000 - - oto105253
Panther 1 1.100 - - LDO PTHR21237
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R526
SonicParanoid 1 1.000 - - X1249
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.