DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roe1 and mge1

DIOPT Version :9

Sequence 1:NP_610886.2 Gene:Roe1 / 36508 FlyBaseID:FBgn0014877 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_596677.1 Gene:mge1 / 2541039 PomBaseID:SPBC3B9.19 Length:223 Species:Schizosaccharomyces pombe


Alignment Length:198 Identity:75/198 - (37%)
Similarity:111/198 - (56%) Gaps:12/198 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NMSALRLYSTEKQPEE--ATEQKATESSPEVEKLTKELAAAK-------EQNAELMDKYKRSLAD 82
            |..:...||||...||  |.|:.|...:.:|::|..:|:..|       ::.|||....::||||
pombe    23 NKRSFLWYSTEAAKEEKPAEEKVAETENVDVKELQSKLSELKSKYEAKDKEVAELKGSIRQSLAD 87

  Fly    83 SENMRNRLNKQISDAKIFGIQSFCKDLLEVADTLGHATQAVPKDKLS---GNADLKNLYEGLTMT 144
            ..|:.||:.:.:...:.|.:|...||||:..|.|..|...||::|.:   .|.||.:|||||.||
pombe    88 YRNLENRMKRDMEQTRAFAVQKLTKDLLDSVDNLERALSIVPEEKRNNRESNKDLVDLYEGLAMT 152

  Fly   145 RASLLQVFKRHGLEPLDPINQKFDPNQHEALFQKEDKTVEPNTVVEVTKLGYKLHERCIRPALVG 209
            .::|::...::||...|.|.:.||||.|||:||...:..:||||......|::|:.|.||||.||
pombe   153 ESNLMKTLGKYGLVRYDGIGEDFDPNIHEAVFQIPVEGKKPNTVFHCESKGFQLNGRVIRPAKVG 217

  Fly   210 VSK 212
            |.|
pombe   218 VVK 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roe1NP_610886.2 GrpE 70..210 CDD:271355 58/142 (41%)
2-helical coiled coil 70..120 CDD:271355 18/49 (37%)
2-helical coiled coil 140..155 CDD:271355 5/14 (36%)
mge1NP_596677.1 GrpE 75..218 CDD:271355 58/142 (41%)
2-helical coiled coil 75..125 CDD:271355 18/49 (37%)
2-helical coiled coil 148..163 CDD:271355 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1495
eggNOG 1 0.900 - - E1_COG0576
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6992
Inparanoid 1 1.050 124 1.000 Inparanoid score I1461
OMA 1 1.010 - - QHG61230
OrthoFinder 1 1.000 - - FOG0001525
OrthoInspector 1 1.000 - - oto102009
orthoMCL 1 0.900 - - OOG6_100642
Panther 1 1.100 - - LDO PTHR21237
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R526
SonicParanoid 1 1.000 - - X1249
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.