DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roe1 and Grpel2

DIOPT Version :9

Sequence 1:NP_610886.2 Gene:Roe1 / 36508 FlyBaseID:FBgn0014877 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_067271.1 Gene:Grpel2 / 17714 MGIID:1334416 Length:224 Species:Mus musculus


Alignment Length:231 Identity:84/231 - (36%)
Similarity:121/231 - (52%) Gaps:34/231 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAKAALPLQMFGRRLVHLRSSVTSQNMSALRLYSTEKQPEEATEQKATESSPE----------- 54
            |:|::...:|...|.|.   |...|::...|..:||..| ..|.|..::|..|:           
Mouse     1 MAARSLWAVQRLQRLLA---SGAMSESRGWLHPFSTATQ-RTAGEDCSSEDPPDGLGPSLAEQAL 61

  Fly    55 ---VEKLTKELAAAKEQNAELMDKYKRSLADSENMRNRLNKQISDAKIFGIQSFCKDLLEVADTL 116
               ..||.||:       .:|..:|:|::||.||:|.|..:.:.||||||||||||||:||||.|
Mouse    62 RLKAVKLEKEV-------QDLTLRYQRAVADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADIL 119

  Fly   117 GHATQ-----AVPKDKLSGNADLKNLYEGLTMTRASLLQVFKRHGLEPLDPINQKFDPNQHEAL- 175
            ....:     |.|:|.   ...|:.:::||::..|.|..||.:||||.:.||..|:||::||.: 
Mouse   120 EKTAKCCSEGAEPEDH---RRTLEKVFQGLSLLEARLKSVFTKHGLEKMTPIGDKYDPHEHELIC 181

  Fly   176 FQKEDKTVEPNTVVEVTKLGYKLHERCIRPALVGVS 211
            .......|:|.||..|.:.|||||.|.||.|.|.|:
Mouse   182 HMPAGVGVQPGTVALVRQDGYKLHGRTIRLAQVEVA 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roe1NP_610886.2 GrpE 70..210 CDD:271355 64/145 (44%)
2-helical coiled coil 70..120 CDD:271355 28/49 (57%)
2-helical coiled coil 140..155 CDD:271355 6/14 (43%)
Grpel2NP_067271.1 GrpE 73..216 CDD:271355 64/145 (44%)
2-helical coiled coil 73..123 CDD:271355 28/49 (57%)
2-helical coiled coil 145..160 CDD:271355 6/14 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837850
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0576
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61230
OrthoDB 1 1.010 - - D1525208at2759
OrthoFinder 1 1.000 - - FOG0001525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100642
Panther 1 1.100 - - O PTHR21237
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1249
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.720

Return to query results.
Submit another query.