DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roe1 and GRPEL2

DIOPT Version :9

Sequence 1:NP_610886.2 Gene:Roe1 / 36508 FlyBaseID:FBgn0014877 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_689620.2 Gene:GRPEL2 / 134266 HGNCID:21060 Length:225 Species:Homo sapiens


Alignment Length:178 Identity:75/178 - (42%)
Similarity:101/178 - (56%) Gaps:25/178 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EEATEQKATESSPEVEKLTKELAAAKEQNAELMDKYKRSLADSENMRNRLNKQISDAKIFGIQSF 105
            |.|...||.:...||:.||.              :|:|::||.||:|.|..:.:.||||||||||
Human    59 ERALRVKAVKLEKEVQDLTV--------------RYQRAIADCENIRRRTQRCVEDAKIFGIQSF 109

  Fly   106 CKDLLEVADTLGHATQAV-----PKD-KLSGNADLKNLYEGLTMTRASLLQVFKRHGLEPLDPIN 164
            ||||:||||.|...|:.:     |:| ||:    |:.::.||.:..|.|..||.:||||.|.||.
Human   110 CKDLVEVADILEKTTECISEESEPEDQKLT----LEKVFRGLLLLEAKLKSVFAKHGLEKLTPIG 170

  Fly   165 QKFDPNQHEALFQ-KEDKTVEPNTVVEVTKLGYKLHERCIRPALVGVS 211
            .|:||::||.:.. .....|:|.||..|.:.|||||.|.||.|.|.|:
Human   171 DKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVA 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roe1NP_610886.2 GrpE 70..210 CDD:271355 66/146 (45%)
2-helical coiled coil 70..120 CDD:271355 27/49 (55%)
2-helical coiled coil 140..155 CDD:271355 6/14 (43%)
GRPEL2NP_689620.2 GrpE 74..217 CDD:271355 68/160 (43%)
2-helical coiled coil 74..124 CDD:271355 29/63 (46%)
2-helical coiled coil 146..161 CDD:271355 6/14 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147768
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0576
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61230
OrthoDB 1 1.010 - - D1525208at2759
OrthoFinder 1 1.000 - - FOG0001525
OrthoInspector 1 1.000 - - otm42146
orthoMCL 1 0.900 - - OOG6_100642
Panther 1 1.100 - - O PTHR21237
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1249
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.720

Return to query results.
Submit another query.