DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roe1 and grpel2

DIOPT Version :9

Sequence 1:NP_610886.2 Gene:Roe1 / 36508 FlyBaseID:FBgn0014877 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001135688.1 Gene:grpel2 / 100216254 XenbaseID:XB-GENE-490766 Length:216 Species:Xenopus tropicalis


Alignment Length:185 Identity:66/185 - (35%)
Similarity:103/185 - (55%) Gaps:13/185 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YSTEKQPEEATEQKAT-------ESSPEVEKLTKELAAAKEQNAELMDKYKRSLADSENMRNRLN 91
            |||..|...|.:|...       :.|..|..|.::....:|:..:|.::|||::|||||:|.|..
 Frog    33 YSTAAQQRSAGDQTTADDNTVDDQQSYAVRALERKALKLEEEVRDLSERYKRAIADSENVRKRTQ 97

  Fly    92 KQISDAKIFGIQSFCKDLLEVADTLGHATQAVPKDKLSGNADLKNLYEGLTMTRASLLQVFKRHG 156
            |.:.|||:|||||||:||:|||||:..|.:...|:.:...|.:.:..:|      .|..||.:||
 Frog    98 KFVEDAKLFGIQSFCRDLVEVADTIEQAVEKATKEGIRDMAAVLSHLDG------KLQGVFIKHG 156

  Fly   157 LEPLDPINQKFDPNQHEALFQKEDKTVEPNTVVEVTKLGYKLHERCIRPALVGVS 211
            |:.:.|:..::||..||.:........:|.::..::..|||||.|.||.|.||::
 Frog   157 LQKMTPLEGEYDPYDHEIVCHVPADGKKPGSIATISLDGYKLHGRTIRHAQVGIA 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roe1NP_610886.2 GrpE 70..210 CDD:271355 55/139 (40%)
2-helical coiled coil 70..120 CDD:271355 29/49 (59%)
2-helical coiled coil 140..155 CDD:271355 4/14 (29%)
grpel2NP_001135688.1 GrpE 76..210 CDD:271355 55/139 (40%)
2-helical coiled coil 76..126 CDD:271355 29/49 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1525208at2759
OrthoFinder 1 1.000 - - FOG0001525
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21237
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1249
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.