DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roe1 and grpel2

DIOPT Version :9

Sequence 1:NP_610886.2 Gene:Roe1 / 36508 FlyBaseID:FBgn0014877 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001275592.1 Gene:grpel2 / 100004941 ZFINID:ZDB-GENE-091204-188 Length:217 Species:Danio rerio


Alignment Length:219 Identity:77/219 - (35%)
Similarity:115/219 - (52%) Gaps:21/219 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAKAALPLQMFGRRLVHLRSSVTSQNMSALRLYSTEKQPEEA-----TEQKATESSPEVEKL-T 59
            :||....|:.:       .|.:.::...||:.|:||..:...|     .|.:..:.|..|..: |
Zfish     6 LSATRRNPIDL-------CRLTPSAVTRSAVGLFSTAAEQRSAGDDCHGEDRDDDHSHAVTHVRT 63

  Fly    60 KELAAAK--EQNAELMDKYKRSLADSENMRNRLNKQISDAKIFGIQSFCKDLLEVADTLGHATQA 122
            .|:.|.|  ||..:|.::|||::|||:|:|.|..|.:.|||:|||||||:||:||||.|......
Zfish    64 LEMRARKLEEQVHDLTERYKRAVADSDNVRRRTQKFVEDAKLFGIQSFCRDLVEVADLLEKNLTV 128

  Fly   123 VPKDKLSGNADLKNLYEGLTMTRASLLQVFKRHGLEPLDPINQKFDPNQHEALFQKEDKTVEPNT 187
            ...|      ..:.|.:.|...:..|..:|.:||||.:.|:...:||.|||.:.....:..||.|
Zfish   129 EESD------GAQQLAQYLAHIQERLQDIFTKHGLEKMTPVGTTYDPYQHEIVCHTPAEGAEPGT 187

  Fly   188 VVEVTKLGYKLHERCIRPALVGVS 211
            :..|.:.||.||.|.||.||||::
Zfish   188 IAMVKQDGYMLHGRTIRHALVGIA 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roe1NP_610886.2 GrpE 70..210 CDD:271355 57/139 (41%)
2-helical coiled coil 70..120 CDD:271355 28/49 (57%)
2-helical coiled coil 140..155 CDD:271355 3/14 (21%)
grpel2NP_001275592.1 GrpE 77..210 CDD:271355 57/138 (41%)
2-helical coiled coil 77..126 CDD:271355 28/48 (58%)
2-helical coiled coil 140..155 CDD:271355 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581603
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0576
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61230
OrthoDB 1 1.010 - - D1525208at2759
OrthoFinder 1 1.000 - - FOG0001525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100642
Panther 1 1.100 - - O PTHR21237
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1249
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.