DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6145 and nadk-1

DIOPT Version :9

Sequence 1:NP_725314.1 Gene:CG6145 / 36506 FlyBaseID:FBgn0033853 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_500084.2 Gene:nadk-1 / 176954 WormBaseID:WBGene00022307 Length:370 Species:Caenorhabditis elegans


Alignment Length:224 Identity:51/224 - (22%)
Similarity:86/224 - (38%) Gaps:60/224 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 LEQESSKFQKVHQ-----QYAGVRARFLDLREKLVTFKDGRDDLTDRIDFIVCLGGDGTLLYASQ 261
            ||.|..:...|.:     ..||:..:.: .||:|..:       ....|.::..|||||.|.|:.
 Worm    75 LENEKKQVNAVQEIVSELGKAGISTKVV-TREQLAQY-------LPEADLVISAGGDGTFLAAAS 131

  Fly   262 LFQQSVP-------PVMAFYLGSLGFLTPFQCDNFQEQVTNVLEGHAALTLRSRLRCSIHRKGER 319
            :...:.|       |:     ||.|.|.....:..::.:..::.|:.....|:|:|.::      
 Worm   132 VVNDNTPIIGINTDPI-----GSEGHLCVGGKNPPRDLIERLVSGNLKWVQRTRIRVTV------ 185

  Fly   320 RKESLLHSVGGNLLIPSFQRQLNYVELNNGQTGKAGSNNNNGHNNSILVLNEVVINRGPSPYLSN 384
             |||                      .|:..:.|....:.|      |.||||.|....:..:|.
 Worm   186 -KES----------------------RNSIFSLKRSEKSTN------LALNEVFIGEDEAAKVST 221

  Fly   385 IDIFLEGKYITSVQGDGLIVSTPTGSTAY 413
            .:|.::.......:..||||||.||||::
 Worm   222 YNISIDDSQTVKQKSSGLIVSTGTGSTSW 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6145NP_725314.1 DAGK_cat <146..519 CDD:294771 51/224 (23%)
nadk-1NP_500084.2 DAGK_cat 69..>248 CDD:294771 49/220 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1835
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.