DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mip120 and AT5G25790

DIOPT Version :9

Sequence 1:NP_001163143.1 Gene:mip120 / 36499 FlyBaseID:FBgn0033846 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_001332765.1 Gene:AT5G25790 / 832648 AraportID:AT5G25790 Length:504 Species:Arabidopsis thaliana


Alignment Length:291 Identity:94/291 - (32%)
Similarity:129/291 - (44%) Gaps:90/291 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   643 KTRRPPPISP----QQHRFKQMGPQQ----QSKHQQLQAQAKQRIRQQQLPTEQSTPIKVEPKLP 699
            |:..|||.||    ||...:...||:    |..|.|:|   |.|:..|. |:......:||.   
plant    28 KSLEPPPCSPVKSSQQSETEVTPPQKPPLHQFGHNQVQ---KNRVSNQD-PSTSRRHNEVES--- 85

  Fly   700 TLPPGVKANVPAKPLFEVLKPPATAAAAGAVDPLGGMTSRRKHCNCSKSQCLKLYCDCFANGEFC 764
                  |.|.|.|                          ::|||||..|:||||||:|||:|.:|
plant    86 ------KENTPNK--------------------------QQKHCNCKNSKCLKLYCECFASGSYC 118

  Fly   765 QDCTCKDCFNNLDYEVERERAIRSCLDRNPSAFKPKITAPNSGDMRL------------HNKGCN 817
            ..|.|.:|.|.|:.|..|:.||...|:|||.||||||.....|...|            |:|||:
plant   119 NGCNCVNCHNKLENESSRQVAISGILERNPDAFKPKIAGSPHGMKDLQENVQQVLLIGKHSKGCH 183

  Fly   818 CKRSGCLKNYCECYEAKIPCSSICKCVGCRNMEDRPD--------------------------VD 856
            |::|||||.|||||:|.|.||..|:|..|:|.|...:                          :|
plant   184 CRKSGCLKKYCECYQANILCSENCRCQDCKNFEGSEERKALLHGSQVSDTYIQQMTNAAVNRAID 248

  Fly   857 MDSLDGLMGVEGQKKDKAKNKQLNENRANIY 887
            |.:.  |...|.:|:   |:|.::::..:.|
plant   249 MSAY--LYPPESRKR---KSKDISDSVVSSY 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mip120NP_001163143.1 TCR 740..775 CDD:281618 20/34 (59%)
TCR 813..850 CDD:281618 22/36 (61%)
AT5G25790NP_001332765.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3659
eggNOG 1 0.900 - - E1_KOG1171
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003047
OrthoInspector 1 1.000 - - otm2962
orthoMCL 1 0.900 - - OOG6_106892
Panther 1 1.100 - - O PTHR12446
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1765
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.