DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mip120 and AT3G16160

DIOPT Version :9

Sequence 1:NP_001163143.1 Gene:mip120 / 36499 FlyBaseID:FBgn0033846 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_188237.2 Gene:AT3G16160 / 820861 AraportID:AT3G16160 Length:368 Species:Arabidopsis thaliana


Alignment Length:284 Identity:89/284 - (31%)
Similarity:145/284 - (51%) Gaps:26/284 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   683 QLPTEQSTPIKVEPKLPTLPPGVKANVPAKPLFEVLKPPATAAAAGAVDPLG--GMTSRR-KHCN 744
            ::.||:.....|..||...|...::.|...|||    ||.:...:.|.|...  |:|||: |.|.
plant     9 KIATEKDPRKLVFTKLEVSPVFRESPVKELPLF----PPISREHSEAKDKTDEEGITSRKHKGCR 69

  Fly   745 CSKSQCLKLYCDCFANGEFCQDCTCKDCFNNLDYEVERERAIRSCLDRNPSAFKPKI-------- 801
            |.:|:||||||||||:|..|.||.|.||.||.:....||.|:.:.|.|||:||..|.        
plant    70 CKQSKCLKLYCDCFASGVVCTDCDCVDCHNNSEKCDAREAAMVNVLGRNPNAFSEKALGSLTDNQ 134

  Fly   802 --TAPNSGDMRLHNKGCNCKRSGCLKNYCECYEAKIPCSSICKCVGCRNMEDRPDVDMDSLDGLM 864
              .||:: ...|.::||.|||:.|||.||||::|.:.||..|||:.|:|:.:.......|.....
plant   135 CKAAPDT-KPGLLSRGCKCKRTRCLKKYCECFQANLLCSDNCKCINCKNVSEAFQPPAFSAHNSP 198

  Fly   865 GVEGQKKDKAKNKQLNENRANIY-FTDDVIEATI---MCMISRIVMHEKQNVAVEDMEREVMEEM 925
            .|..:::|: :..:.|...|.:: ..|:.|:..:   |....::...:|:::.  .....::.::
plant   199 QVYRRRRDR-ELTEWNSCPAPLFSIPDNSIQNALGSPMSCSPKLPYRKKRSLM--GYTSTLLPDL 260

  Fly   926 GESLTQIIAFAKEKQETSQIDESK 949
            |: |..::..|.|...|:..|:::
plant   261 GD-LCSLLVAASESATTTAEDQNR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mip120NP_001163143.1 TCR 740..775 CDD:281618 21/35 (60%)
TCR 813..850 CDD:281618 20/36 (56%)
AT3G16160NP_188237.2 TCR 65..101 CDD:281618 22/35 (63%)
TCR 147..182 CDD:281618 19/34 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3660
eggNOG 1 0.900 - - E1_KOG1171
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003047
OrthoInspector 1 1.000 - - otm2962
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12446
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.