powered by:
Protein Alignment mip120 and tomb
DIOPT Version :9
Sequence 1: | NP_001163143.1 |
Gene: | mip120 / 36499 |
FlyBaseID: | FBgn0033846 |
Length: | 952 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_608936.1 |
Gene: | tomb / 33779 |
FlyBaseID: | FBgn0031715 |
Length: | 243 |
Species: | Drosophila melanogaster |
Alignment Length: | 47 |
Identity: | 27/47 - (57%) |
Similarity: | 35/47 - (74%) |
Gaps: | 0/47 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 814 KGCNCKRSGCLKNYCECYEAKIPCSSICKCVGCRNMEDRPDVDMDSL 860
|||.||||.|:||||:||::...|:..|:||||||.|.|..||.:|:
Fly 26 KGCCCKRSQCIKNYCDCYQSMAICTKFCRCVGCRNTEVRELVDPNSV 72
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
mip120 | NP_001163143.1 |
TCR |
740..775 |
CDD:281618 |
|
TCR |
813..850 |
CDD:281618 |
22/35 (63%) |
tomb | NP_608936.1 |
TCR |
28..62 |
CDD:281618 |
20/33 (61%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1171 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12446 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.