DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mip120 and tomb

DIOPT Version :9

Sequence 1:NP_001163143.1 Gene:mip120 / 36499 FlyBaseID:FBgn0033846 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_608936.1 Gene:tomb / 33779 FlyBaseID:FBgn0031715 Length:243 Species:Drosophila melanogaster


Alignment Length:47 Identity:27/47 - (57%)
Similarity:35/47 - (74%) Gaps:0/47 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   814 KGCNCKRSGCLKNYCECYEAKIPCSSICKCVGCRNMEDRPDVDMDSL 860
            |||.||||.|:||||:||::...|:..|:||||||.|.|..||.:|:
  Fly    26 KGCCCKRSQCIKNYCDCYQSMAICTKFCRCVGCRNTEVRELVDPNSV 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mip120NP_001163143.1 TCR 740..775 CDD:281618
TCR 813..850 CDD:281618 22/35 (63%)
tombNP_608936.1 TCR 28..62 CDD:281618 20/33 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1171
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12446
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.