DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf150 and SPCC4G3.12c

DIOPT Version :9

Sequence 1:NP_001178022.1 Gene:Rnf150 / 364983 RGDID:1304572 Length:437 Species:Rattus norvegicus
Sequence 2:NP_587826.1 Gene:SPCC4G3.12c / 2539364 PomBaseID:SPCC4G3.12c Length:821 Species:Schizosaccharomyces pombe


Alignment Length:94 Identity:32/94 - (34%)
Similarity:48/94 - (51%) Gaps:15/94 - (15%)


- Green bases have known domain annotations that are detailed below.


  Rat   247 LGDAAKKAISKLQVRTIRKG------DKETESDFDNCAVCIEGYKPSDVVRIL-PCRHLFHKSCV 304
            ||.|.|...|...|:  |.|      |..:.|..|:|.:|:|.|...|:.|.| .|:|.||::|:
pombe   732 LGPAKKPVASHEDVK--RSGGLFAYFDDASLSSADSCLICLETYTNGDICRKLQACKHFFHQACI 794

  Rat   305 DPWL-LDHRTCPMCKMNILKALGIPPNAD 332
            |.|| ..:.:||:|     :|.|:...|:
pombe   795 DQWLTTGNNSCPLC-----RAHGVTTQAE 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf150NP_001178022.1 PA_GRAIL_like 45..192 CDD:239037
UPF0233 <206..>231 CDD:299753
zf-RING_2 275..318 CDD:290367 18/44 (41%)
SPCC4G3.12cNP_587826.1 zf-RING_2 764..809 CDD:290367 19/49 (39%)
zf-rbx1 <764..809 CDD:289448 19/49 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 55 1.000 Domainoid score I3559
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.