DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mars and Il1rapl1

DIOPT Version :9

Sequence 1:NP_001163142.1 Gene:mars / 36498 FlyBaseID:FBgn0033845 Length:921 Species:Drosophila melanogaster
Sequence 2:NP_001153875.1 Gene:Il1rapl1 / 331461 MGIID:2687319 Length:696 Species:Mus musculus


Alignment Length:193 Identity:40/193 - (20%)
Similarity:59/193 - (30%) Gaps:71/193 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   711 PKISRNMKIKSKAKPSSNLQQFLRKAHANMKKTKVEEPTLEDGLPATSSRHSSPRVIVVRNRRSF 775
            ||.:   |:.||         |.::....|...::|..|.|..|.             |..:..|
Mouse   542 PKCN---KLNSK---------FWKRLQYEMPFKRIEPITHEQALD-------------VSEQGPF 581

  Fly   776 SPARTVLRMSTGEGRQSIAPNALLKSAILAAAEQNAAKTPPPKPRTSILKTPGTTKRQNRGVLFS 840
            ...:||..:|                  :|||...|..|..|..|::...|..:..||       
Mouse   582 GELQTVSAIS------------------MAAATSTALATAHPDLRSTFHNTYHSQMRQ------- 621

  Fly   841 AKKSVRRFQF------TYEEGNISNDETVGADKLEDCEEDMSLEASTESGSLEQNPGRDSNQE 897
             |...|.:::      |....:|.|..|.       |...|:|...       |.|...||:|
Mouse   622 -KHYYRSYEYDVPPTGTLPLTSIGNQHTY-------CNIPMTLING-------QRPQTKSNRE 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
marsNP_001163142.1 GKAP <558..>703 CDD:281368
Il1rapl1NP_001153875.1 PHA02785 9..334 CDD:165149
Ig1_IL1RAPL-1_like 32..135 CDD:143304
Ig 148..234 CDD:299845
IGc2 260..341 CDD:197706
TIR 405..559 CDD:279864 6/28 (21%)
Interaction with NCS1. /evidence=ECO:0000250 549..644 26/142 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 658..680 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3971
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.