| Sequence 1: | NP_001163142.1 | Gene: | mars / 36498 | FlyBaseID: | FBgn0033845 | Length: | 921 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_808796.1 | Gene: | Il1rapl1 / 317553 | RGDID: | 727891 | Length: | 696 | Species: | Rattus norvegicus |
| Alignment Length: | 200 | Identity: | 44/200 - (22%) |
|---|---|---|---|
| Similarity: | 63/200 - (31%) | Gaps: | 71/200 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 711 PKISRNMKIKSKAKPSSNLQQFLRKAHANMKKTKVEEPTLEDGLPATSSRHSSPRVIVVRNRRSF 775
Fly 776 SPARTVLRMSTGEGRQSIAPNALLKSAILAAAEQNAAKTPPPKPRTSILKTPGTTKRQNRGVLFS 840
Fly 841 AKKSVRRFQF------TYEEGNISNDETVGADKLEDCEEDMSL----EASTESGSLEQNPGRDSN 895
Fly 896 QENEA 900 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| mars | NP_001163142.1 | GKAP | <558..>703 | CDD:281368 | |
| Il1rapl1 | NP_808796.1 | PHA02785 | 9..334 | CDD:165149 | |
| Ig1_IL1RAPL-1_like | 32..135 | CDD:143304 | |||
| Ig | 148..234 | CDD:299845 | |||
| IGc2 | 260..341 | CDD:197706 | |||
| TIR | 405..559 | CDD:279864 | 6/28 (21%) | ||
| Interaction with NCS1. /evidence=ECO:0000250 | 549..644 | 26/142 (18%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 659..680 | 8/23 (35%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3971 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||