DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mars and IL1RAPL2

DIOPT Version :9

Sequence 1:NP_001163142.1 Gene:mars / 36498 FlyBaseID:FBgn0033845 Length:921 Species:Drosophila melanogaster
Sequence 2:NP_059112.1 Gene:IL1RAPL2 / 26280 HGNCID:5997 Length:686 Species:Homo sapiens


Alignment Length:211 Identity:45/211 - (21%)
Similarity:77/211 - (36%) Gaps:62/211 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RLDTKPAELLKESNPKVSRQKLYLQRYMEWKIAKTKEHKQQDQKRRGAAINVPTVKQSKALPKSQ 143
            :::.:..|.||.|        :.|...::||.:|:.                   |.:....|..
Human   515 KVNCQEVESLKRS--------IKLLSLIKWKGSKSS-------------------KLNSKFWKHL 552

  Fly   144 TFRVPDNLASAKQKEAAPMFQPPKRCSLYMIANPTGKGKAAEPIKPSIPKPTSAAAPPSSNT--- 205
            .:.:|     .|:||..|      ||.:...|. .|.....:|| |||...:::|...||..   
Human   553 VYEMP-----IKKKEMLP------RCHVLDSAE-QGLFGELQPI-PSIAMTSTSATLVSSQADLP 604

  Fly   206 --VAASSALARH-----KSAASATKI-VPAIRQN----NNPVALARQKAAARPIPNTTKQTTSVR 258
              ..:.|...||     |....||.: ||::..:    |.|:.|...:.   |:.||.|.|....
Human   605 EFHPSDSMQIRHCCRGYKHEIPATTLPVPSLGNHHTYCNLPLTLLNGQL---PLNNTLKDTQEFH 666

  Fly   259 QPG----IEAKKITTT 270
            :..    :.:|:::.|
Human   667 RNSSLLPLSSKELSFT 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
marsNP_001163142.1 GKAP <558..>703 CDD:281368
IL1RAPL2NP_059112.1 Ig 32..133 CDD:325142
Ig2_IL1R_like 146..237 CDD:319309
IG_like 250..347 CDD:214653
TIR 402..563 CDD:307630 13/79 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3971
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.