DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mars and il1rapl2

DIOPT Version :9

Sequence 1:NP_001163142.1 Gene:mars / 36498 FlyBaseID:FBgn0033845 Length:921 Species:Drosophila melanogaster
Sequence 2:NP_001136056.1 Gene:il1rapl2 / 100149452 ZFINID:ZDB-GENE-040219-5 Length:681 Species:Danio rerio


Alignment Length:273 Identity:54/273 - (19%)
Similarity:84/273 - (30%) Gaps:104/273 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 SGHLLEAFGDTILLSPVAPVKAEGESS---------------VKRQLLPEGKKE----ASGPVAK 475
            |||.|...||:|...     .||.|.:               |...|..|..:|    :|....:
Zfish    90 SGHRLSKEGDSIWFR-----SAEMEDNGFYTCVLRNSTYCMKVSMSLTVEESEEGLCFSSRIRYQ 149

  Fly   476 KKFDFTRYSVANSPAEDSLIL---DPQQTTVKE---DTGDSTLVPEGTK--TPPRRESNGMPNYL 532
            ::.:.|:..:.:.|..|..:.   .|..|..||   ....|:::...|.  .|..:|.:| .|| 
Zfish   150 ERAEITKSKMISCPDIDDYLAPYKQPIMTWYKECQRKEWRSSIIINTTSLWIPEVQEDDG-GNY- 212

  Fly   533 SPFVSVSRGKVNSRCEKEKRNSFYLSNEESPLEVRRAIESVLYFRLQLENEITRLQALCAEWEAY 597
                         .||.:..:..          |||..|.          ::|.|.........:
Zfish   213 -------------TCELKYGSKV----------VRRTTEL----------KVTALLTTRPPKVLF 244

  Fly   598 SKENEARLQETGGIDMINVTIGQTRLLTTKKMMQFSGLIDRCEAGATGKNSQPNDGSEDSKPV-- 660
            ..|.:|        .:|:|.:|...:|..|....:||                     ||||:  
Zfish   245 PSERQA--------SVIDVQLGMRLILDCKAFFGYSG---------------------DSKPIIY 280

  Fly   661 ------QAEDLEG 667
                  ..|:|||
Zfish   281 WMKGDKFVEELEG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
marsNP_001163142.1 GKAP <558..>703 CDD:281368 23/118 (19%)
il1rapl2NP_001136056.1 Ig 32..133 CDD:299845 12/47 (26%)
IG_like 39..133 CDD:214653 12/47 (26%)
Ig 146..232 CDD:299845 20/120 (17%)
IG_like 160..231 CDD:214653 19/105 (18%)
I-set 247..347 CDD:254352 17/76 (22%)
Ig 253..347 CDD:299845 15/62 (24%)
TIR 400..558 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3971
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.