DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and HSE1

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_011861.1 Gene:HSE1 / 856387 SGDID:S000000994 Length:452 Species:Saccharomyces cerevisiae


Alignment Length:100 Identity:32/100 - (32%)
Similarity:48/100 - (48%) Gaps:22/100 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LVEYHRTASVSRSQDVKLRDMIPEEM---------------------LVQALYDFVPQESGELDF 173
            |.||.:...: :.|:.:..:::|::.                     .|:||||....|..||.|
Yeast   175 LFEYEKQKKL-QEQEKESAEVLPQQQQQHQQQNQAPAHKIPAQTVVRRVRALYDLTTNEPDELSF 238

  Fly   174 RRGDVITVTDRSDENWWNGEIGNRKGIFPATYVTP 208
            |:||||||.::...:||.|.:....||||..||||
Yeast   239 RKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738
SH2_Grb2_like 56..149 CDD:199828 4/18 (22%)
SH3_GRB2_like_C 156..208 CDD:212739 25/51 (49%)
HSE1NP_011861.1 VHS_HSE1 8..140 CDD:340775
SH3_GRB2_like_C 221..273 CDD:212739 25/51 (49%)
GAT_Hse1 290..374 CDD:410591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.