DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment drk and RVS167

DIOPT Version :9

Sequence 1:	NP_476858.1	Gene:	drk / 36497	FlyBaseID:	FBgn0004638	Length:	211	Species:	Drosophila melanogaster
Sequence 2:	NP_010676.1	Gene:	RVS167 / 851996	SGDID:	S000002796	Length:	482	Species:	Saccharomyces cerevisiae

Alignment Length:	52	Identity:	21/52 - (40%)
Similarity:	30/52 - (57%)	Gaps:	2/52 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   157 VQALYDFVPQESGELDFRRGDVITVTDRSDE--NWWNGEIGNRKGIFPATYV 206
            |.||||:..|.:|:|.|..|.||.:..|:.:  .||.|....::|:||..||
Yeast   426 VTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYV 477

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
drk	NP_476858.1	SH3_GRB2_like_N	2..53	CDD:212738
		SH2_Grb2_like	56..149	CDD:199828
		SH3_GRB2_like_C	156..208	CDD:212739	21/52 (40%)
RVS167	NP_010676.1	BAR_Rvs167p	29..245	CDD:153283
RVS167	NP_010676.1	SH3	425..478	CDD:418401	21/52 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	60	1.000	Domainoid score	I2555
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	1	1.000	-	-		otm46831
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	2.000