DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and AT5G57610

DIOPT Version :10

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_200569.1 Gene:AT5G57610 / 835865 AraportID:AT5G57610 Length:1054 Species:Arabidopsis thaliana


Alignment Length:114 Identity:27/114 - (23%)
Similarity:42/114 - (36%) Gaps:28/114 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LWVVKFNSLNELVEYHRTASVSRSQDVKLRDMIPEEMLVQALYDFVPQESGELDFRRGDVITVTD 183
            |.|.:.:.|.||:|..:.|::..:.:||..   |||...|...:.|..||..::.:....|   |
plant   690 LSVERLSFLPELMESVKRAALEGAAEVKAH---PEEAKDQVRPELVENESEHMNAQDEPEI---D 748

  Fly   184 RSDENWWNGEIGNRKGIFPA----------------------TYVTPYH 210
            ...:|..|.:|...|....|                      ||.:.||
plant   749 SDSDNPNNFKIEQTKAEAEAKSRGLQSIRNDDLEEIRELGHGTYGSVYH 797

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738
SH2_Grb2_like 56..149 CDD:199828 9/29 (31%)
SH3_GRB2_like_C 156..208 CDD:212739 13/73 (18%)
AT5G57610NP_200569.1 PB1_UP2 27..123 CDD:99731
STKc_MAP3K-like 787..1044 CDD:270901 4/11 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.