DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and Lyn

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_110484.1 Gene:Lyn / 81515 RGDID:621017 Length:512 Species:Rattus norvegicus


Alignment Length:149 Identity:47/149 - (31%)
Similarity:85/149 - (57%) Gaps:16/149 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAE-LDGK-EGLIPSNYI----EMKNHDWYY 62
            :|.:.:.....|:|||:|.:.:|:|  |:...|::|: |..| ||.|||||:    .::..:|::
  Rat    69 VALYPYDGIHPDDLSFKKGEKMKVL--EEHGEWWKAKSLSSKREGFIPSNYVAKVN
TLETEEWFF 131

  Fly    63 GRITRADAEK--LLSNKHEGAFLIRISESSPGDFSLSVK-----CPDGVQHFKVLRDAQSKFFLW 120
            ..|||.|||:  |......||||||.||:..|.|||||:     ..|.::|:|:.......:::.
  Rat   132 KDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDYDPMHGDVIKHYKIRSLDNGGYYIS 196

  Fly   121 V-VKFNSLNELVEYHRTAS 138
            . :.|..:::::::::..|
  Rat   197 PRITFPCISDMIKHYQKQS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 19/50 (38%)
SH2_Grb2_like 56..149 CDD:199828 27/91 (30%)
SH3_GRB2_like_C 156..208 CDD:212739
LynNP_110484.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
SH3_Lyn 67..122 CDD:212937 20/54 (37%)
SH2_Src_Lyn 125..225 CDD:198227 27/91 (30%)
PTKc_Lyn 239..510 CDD:270657
Pkinase_Tyr 247..497 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.