DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and STAM

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_003464.1 Gene:STAM / 8027 HGNCID:11357 Length:540 Species:Homo sapiens


Alignment Length:219 Identity:58/219 - (26%)
Similarity:86/219 - (39%) Gaps:52/219 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAKHDFSATADDELSFRKTQI---LKILNMEDDSNWY-RAELDGKEGLIPSNYIEMKNHDWYYGR 64
            :...||::...:.|:....::   ||.|.:|    |. ..:.|.:..||.:....:|.....:..
Human    84 VCSRDFASEVSNVLNKGHPKVCEKLKALMVE----WTDEFKNDPQLSLISAMIKNLKEQGVTF
PA 144

  Fly    65 ITRADAEKLLSNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVVKFNSLNE 129
            |....||:              :::||   :|..|.|..|.:.|...|......|      ||.|
Human   145 IGSQAAEQ--------------AKASP---ALVAKDPGTVANKKEEEDLAKAIEL------SLKE 186

  Fly   130 LVEYHRTASVSRSQDVKLRDMIP-----------EEMLVQALYDFVPQESGELDFRRGDVITVTD 183
                      .|.|...|..:.|           |...|:|:|||...|..||.|:.|::|||.|
Human   187 ----------QRQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVLD 241

  Fly   184 RSDENWWNGEIGNRKGIFPATYVT 207
            .||.|||.||.....|:||:.:||
Human   242 DSDPNWWKGETHQGIGLFPSNFVT 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 11/52 (21%)
SH2_Grb2_like 56..149 CDD:199828 19/92 (21%)
SH3_GRB2_like_C 156..208 CDD:212739 26/52 (50%)
STAMNP_003464.1 VHS_STAM 9..142 CDD:239625 12/61 (20%)
SH3_STAM1 213..267 CDD:212897 26/53 (49%)
GAT 306..377 CDD:281166
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..540
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.