DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and Frk

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_077344.1 Gene:Frk / 79209 RGDID:621423 Length:506 Species:Rattus norvegicus


Alignment Length:150 Identity:59/150 - (39%)
Similarity:82/150 - (54%) Gaps:15/150 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGK--------EGLIPSNYI----EMK 56
            :|..|:.|...::|||.....|::|:...:..|....|:.|        :|.|||||:    .::
  Rat    49 VALFDYEARTAEDLSFHAGDKLQVLDTSHEGWWLARHLEKKGPGLGQQLQGYIPSNY
VAEDRSLQ 113

  Fly    57 NHDWYYGRITRADAEK--LLSNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFL 119
            ...|::|.|.||||||  |.|....||||||.|||..|||||||.....|:|:::.|..:..|||
  Rat   114 AEPWFFGAIKRADAEKQLLYSENQTGAFLIRESESQKGDFSLSVLDEGVVKHYRIRRLDEGGFFL 178

  Fly   120 WVVK-FNSLNELVEYHRTAS 138
            ...| |::|||.|.|:.|.|
  Rat   179 TRRKTFSTLNEFVNYYTTTS 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 16/56 (29%)
SH2_Grb2_like 56..149 CDD:199828 41/85 (48%)
SH3_GRB2_like_C 156..208 CDD:212739
FrkNP_077344.1 SH3_Src_like 48..105 CDD:212779 15/55 (27%)
SH2_Src_Frk 113..208 CDD:199831 41/85 (48%)
PTKc_Frk_like 226..495 CDD:270653
Pkinase_Tyr 235..488 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.