DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and Fgr

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_077059.2 Gene:Fgr / 79113 RGDID:621319 Length:517 Species:Rattus norvegicus


Alignment Length:145 Identity:49/145 - (33%)
Similarity:87/145 - (60%) Gaps:15/145 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAE--LDGKEGLIPSNYI----EMKNHDWYY 62
            :|.:|:.|...|:|:|.|.:...||| ..:.:|:.|.  ..|:.|.:||||:    .::..:||:
  Rat    71 VALYDYEARTGDDLTFTKGEKFHILN-NTEYDWWEARSLSSGRTGYVPSNYVAPVD
SIQAEEWYF 134

  Fly    63 GRITRADAEK-LLSNKH-EGAFLIRISESSPGDFSLSVK-----CPDGVQHFKVLR-DAQSKFFL 119
            |:|:|.|||: |||:.: :||||||.||::.|.:|||::     ..|.::|:|:.: |....:..
  Rat   135 GKISRKDAERQLLSDGNPQGAFLIRESETTKGAYSLSIRDWDQNRGDHIKHYKIRKLDMGGYYIT 199

  Fly   120 WVVKFNSLNELVEYH 134
            ...:|.|:.:||.::
  Rat   200 TRAQFESVQDLVRHY 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 17/50 (34%)
SH2_Grb2_like 56..149 CDD:199828 31/87 (36%)
SH3_GRB2_like_C 156..208 CDD:212739
FgrNP_077059.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..46
SH3 68..125 CDD:418401 18/54 (33%)
SH2_Src_Fgr 128..228 CDD:198230 31/87 (36%)
PKc_like 255..502 CDD:419665
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.