DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and Sla2

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_011238147.1 Gene:Sla2 / 77799 MGIID:1925049 Length:274 Species:Mus musculus


Alignment Length:159 Identity:49/159 - (30%)
Similarity:80/159 - (50%) Gaps:31/159 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AIAKHDFSATADDELSFRKTQILKILNMEDDSNWY--RAELDGKEGLIPSNYIEMKNHDWYYGRI 65
            |:|...|.|.....||.|..:.|.|::  :|.:|:  ::|:.|:|..:||.|:....|.|.|..:
Mouse    36 AVALGSFPAGEQARLSLRLGEPLTIIS--EDGDWWTVQSEVSGREYHMPSVYVAKVAHGWLYEGL 98

  Fly    66 TRADAEK--LLSNKHEGAFLIRISE---------------SSPGDFSLSVKCP-----DGVQHFK 108
            :|..||:  ||.....||||||.|:               ||.|.:||||:..     |.::|::
Mouse    99 SREKAEELLLLPGNPGGAFLIRESQTRRGLSLYLDPPWTLSSLGCYSLSVRLSRPASWDRIRHYR 163

  Fly   109 VLRDAQSKFFLWV---VKFNSLNELVEYH 134
            :.|  ....:|::   :.|.||:.|||::
Mouse   164 IQR--LDNGWLYISPRLTFPSLHALVEHY 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 16/51 (31%)
SH2_Grb2_like 56..149 CDD:199828 32/104 (31%)
SH3_GRB2_like_C 156..208 CDD:212739
Sla2XP_011238147.1 SH3 35..89 CDD:388381 17/54 (31%)
SH2 82..200 CDD:387587 35/111 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.