DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and YES1

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_005424.1 Gene:YES1 / 7525 HGNCID:12841 Length:543 Species:Homo sapiens


Alignment Length:211 Identity:61/211 - (28%)
Similarity:111/211 - (52%) Gaps:31/211 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAE--LDGKEGLIPSNYI----EMKNHDWYY 62
            :|.:|:.|...::|||:|.:..:|:| ..:.:|:.|.  ..||.|.|||||:    .::..:||:
Human    97 VALYDYEARTTEDLSFKKGERFQIIN-NTEGDWWEARSIATGKNGYIPSNYVAPAD
SIQAEEWYF 160

  Fly    63 GRITRADAEKLLSN--KHEGAFLIRISESSPGDFSLSVK-----CPDGVQHFKVLRDAQSKFFLW 120
            |::.|.|||:||.|  ...|.||:|.||::.|.:|||::     ..|.|:|:|:.:.....:::.
Human   161 GKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYIT 225

  Fly   121 V-VKFNSLNELVEYHRTASVSRSQDVKLRDMIP-----EEMLVQALYDFVPQESGELDFRRGDVI 179
            . .:|::|.:||:::...:.....  ||..:.|     .:.|.:..:: :|:||..|:.:.|.  
Human   226 TRAQFDTLQKLVKHYTEHADGLCH--KLTT
VCPTVKPQTQGLAKDAWE-IPRESLRLEVKLGQ-- 285

  Fly   180 TVTDRSDENW---WNG 192
               ....|.|   |||
Human   286 ---GCFGEVWMGTWNG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 18/50 (36%)
SH2_Grb2_like 56..149 CDD:199828 30/100 (30%)
SH3_GRB2_like_C 156..208 CDD:212739 11/40 (28%)
YES1NP_005424.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
SH3_Yes 94..151 CDD:212940 19/54 (35%)
SH2_Src_family 154..253 CDD:199827 30/100 (30%)
PTKc_Yes 264..542 CDD:270654 11/41 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.