DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and Grap

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_082093.1 Gene:Grap / 71520 MGIID:1918770 Length:217 Species:Mus musculus


Alignment Length:216 Identity:114/216 - (52%)
Similarity:145/216 - (67%) Gaps:6/216 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHDWYYGRI 65
            ||::|.:.|.||..|||:|.|...|||||||||.|||:|||.|.||.:|.|||.:|.|.||.|||
Mouse     1 MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGAEGFVPKNYIRVKPHPWYSGRI 65

  Fly    66 TRADAEK-LLSNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVVKFNSLNE 129
            :|..||: |:...|.||||||.||||||:||:||...|.||||||||:|..|:|||..|||||||
Mouse    66 SRQLAEETLMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFLWEEKFNSLNE 130

  Fly   130 LVEYHRTASVSRSQDVKLRDMIP-----EEMLVQALYDFVPQESGELDFRRGDVITVTDRSDENW 189
            ||:::||.::::.:.:.|.|..|     .....||.:||..|:..:|..||||::.|.:|.|.:|
Mouse   131 LVDFYRTTTIAKRRQIFLCDEQPLIKPSRACFAQAQFDFSAQDPSQLSLRRGDIVEVVEREDPHW 195

  Fly   190 WNGEIGNRKGIFPATYVTPYH 210
            |.|..|.|.|.||.:||.|.|
Mouse   196 WRGRAGGRLGFFPRSYVQPVH 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 30/50 (60%)
SH2_Grb2_like 56..149 CDD:199828 54/93 (58%)
SH3_GRB2_like_C 156..208 CDD:212739 23/51 (45%)
GrapNP_082093.1 SH3_GRAP_N 2..55 CDD:212881 32/52 (62%)
SH2_Grb2_like 56..150 CDD:199828 54/93 (58%)
SH3 162..214 CDD:302595 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46063
OrthoDB 1 1.010 - - D1091250at2759
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46037
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X588
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.030

Return to query results.
Submit another query.