DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and SRMS

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_543013.1 Gene:SRMS / 6725 HGNCID:11298 Length:488 Species:Homo sapiens


Alignment Length:171 Identity:50/171 - (29%)
Similarity:90/171 - (52%) Gaps:15/171 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAKHDFSATADDELSFRKTQILKILNMEDDSNW-YRAELDGK--EGLIPSNYI------EMKNHD 59
            :|.:||:|....|||.|:..  ::..:|:...: :...|.|:  .||:|..::      .:.:..
Human    57 LALYDFTARCGGELSVRRGD--RLCALEEGGGYIFARRLSGQPSAGLVPITHVAK
ASPETLSDQP 119

  Fly    60 WYYGRITRADAEKLLSN--KHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVV 122
            ||:..::|..|::||.:  ...||||||.||||.|.:||||:....|.|::|...|....:|...
Human   120 WYFSGVSRTQAQQLLLSPPNEPGAFLIRPSESSLGGYSLSVRAQAKVCHYRVSMAADGSLYLQKG 184

  Fly   123 K-FNSLNELVEYHRTASVSRSQDVKLRDMIPEEMLVQALYD 162
            : |..|.||:.|:: |:....|:..|:..:|::...|.:::
Human   185 RLFPGLEELLTYY
K-ANWKLIQNPLLQPCMPQKAPRQDVWE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 14/51 (27%)
SH2_Grb2_like 56..149 CDD:199828 34/95 (36%)
SH3_GRB2_like_C 156..208 CDD:212739 1/7 (14%)
SRMSNP_543013.1 SH3_Srms 55..109 CDD:212780 14/53 (26%)
SH2 119..197 CDD:301589 30/77 (39%)
PTKc_Srm_Brk 223..483 CDD:133248 0/2 (0%)
STYKc 232..480 CDD:214568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.