DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and SLA

DIOPT Version :10

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_006739.2 Gene:SLA / 6503 HGNCID:10902 Length:316 Species:Homo sapiens


Alignment Length:139 Identity:41/139 - (29%)
Similarity:73/139 - (52%) Gaps:15/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DFSATADDELS-------FRKTQILKILNMEDDSNWYRA-ELD-GKEGLIPSNYIEMKNHDWYYG 63
            ||.|...|..|       ||:.:.|::::  |:..|::| .|. |:|..||...:....|.|.:.
Human    65 DFLAVLSDYPSPDISPPIFRRGEKLRVIS--DEGGWWKAISLSTGRESYIPGICVARVYHGWLFE 127

  Fly    64 RITRADAEKLLS--NKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWV-VKFN 125
            .:.|..||:||.  :...|:|:||.||:..|.:||||:... |:|:::.|...:.:::.. :.|.
Human   128 GLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQ-VKHYRIFRLPNNWYYISPRLTFQ 191

  Fly   126 SLNELVEYH 134
            .|.:||.::
Human   192 CLEDLVNHY 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 16/53 (30%)
SH2_Grb2_like 56..149 CDD:199828 25/82 (30%)
SH3_GRB2_like_C 156..208 CDD:212739
SLANP_006739.2 SH3_SLAP 66..120 CDD:212943 15/55 (27%)
SH2_SLAP 113..210 CDD:198207 26/89 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.